(data stored in SCRATCH zone)

EMBL: CP002105.PE364

CP002105.PE364       Location/Qualifiers
FT   CDS             401304..402407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0369"
FT                   /product="peptidase M48 Ste24p"
FT                   /note="COGs: COG4784 Putative Zn-dependent protease;
FT                   InterPro IPR001915; KEGG: wsu:WS1322 hypothetical protein;
FT                   PFAM: peptidase M48 Ste24p; SPTR: Q7MRI5 Putative
FT                   uncharacterized protein; PFAM: Peptidase family M48"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11916"
FT                   /db_xref="GOA:D9QUC3"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:D9QUC3"
FT                   /protein_id="ADL11916.1"
FT                   /translation="MIGLRKKRIVILLLISFLVLGSISVQAVSDYEKKISQKYLKHYLD
FT                   EYGKADLNSEEKKRVDEIFNKLAAEADKDAPDLEFKYHIIDNSAINAVNIGDGYILIYK
FT                   GLFDLLETDEQLAALIAHEMGHGVNNDIQEKIEINQKIQLGAVIFDLAKDGKLDQDEVS
FT                   PAAEIAVNLLVKKYSRSQEKEADIYSALLLKRTDYDSRGVIGLLRLLKRKSNSVNLELL
FT                   ELMKSHPNLDTRIDYVAEAIKKQKEAEKLYHSPVSTSRELTAGLFRDNLNQVYSAYAER
FT                   IHANLTREQFKDEEQIEKVRKEIANLKEKYNFKYTLELRNQVEGTARVAISFYRNEFTQ
FT                   QNQLVSFAVDLIKDKYGWKVLRGPVAY"
     MIGLRKKRIV ILLLISFLVL GSISVQAVSD YEKKISQKYL KHYLDEYGKA DLNSEEKKRV        60
     DEIFNKLAAE ADKDAPDLEF KYHIIDNSAI NAVNIGDGYI LIYKGLFDLL ETDEQLAALI       120
     AHEMGHGVNN DIQEKIEINQ KIQLGAVIFD LAKDGKLDQD EVSPAAEIAV NLLVKKYSRS       180
     QEKEADIYSA LLLKRTDYDS RGVIGLLRLL KRKSNSVNLE LLELMKSHPN LDTRIDYVAE       240
     AIKKQKEAEK LYHSPVSTSR ELTAGLFRDN LNQVYSAYAE RIHANLTREQ FKDEEQIEKV       300
     RKEIANLKEK YNFKYTLELR NQVEGTARVA ISFYRNEFTQ QNQLVSFAVD LIKDKYGWKV       360
     LRGPVAY                                                                 367
//

If you have problems or comments...

PBIL Back to PBIL home page