(data stored in SCRATCH zone)

EMBL: CP002105.PE373

CP002105.PE373       Location/Qualifiers
FT   CDS             complement(412040..413341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0378"
FT                   /product="transposase, IS605 OrfB family"
FT                   /note="COGs: COG0675 Transposase and inactivated
FT                   derivatives; InterPro IPR010095; KEGG: tex:Teth514_2350
FT                   IS605 family transposase OrfB; PFAM: transposase IS605
FT                   OrfB; SPTR: B0P1C0 Putative uncharacterized protein;
FT                   TIGRFAM: transposase, IS605 OrfB family; PFAM: Putative
FT                   transposase DNA-binding domain; Probable transposase;
FT                   TIGRFAM: transposase, IS605 OrfB family, central region"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11925"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:D9QUD2"
FT                   /protein_id="ADL11925.1"
FT                   /translation="MKLAKHFIHKPNQTQQIVLGCLAYASARLYNIGNYQRKDWSKDSA
FT                   KNYPDWYKQKKQLKDNFWYKNLPSQTAQETLKILADNWDSFYQSMEDYQDNPDKYNGKP
FT                   NSPNYKPKDSKFNFRYLNNGFKIIDGKLRLSIPKQLKEYLKEEYSITNKFLWIRVPNEL
FT                   LSSNRDILNSTTRIEFKPLSDDTYKVILTYKVDTPTIKEDDGNYLSIDLGINNLMTCYS
FT                   NQNQESFIIDGGQYLAINRYFDKKIKHYQSILNGQGKKTSKRIQNLYKKRRKQLFHLIH
FT                   SATKKVVNYCVENNISRVIVGDIKNIRDDADLGKQNNQKLHKLPFDIIYHQLEYKLNLQ
FT                   GITLIKKSEKYTSQCSPYSKKVTKKYANKSNRVKRGLYIDKDNNQAFNADSIGAFNILR
FT                   KYLQQRRKGPDITLQVKGLSNPVKYNWNNHQFAA"
     MKLAKHFIHK PNQTQQIVLG CLAYASARLY NIGNYQRKDW SKDSAKNYPD WYKQKKQLKD        60
     NFWYKNLPSQ TAQETLKILA DNWDSFYQSM EDYQDNPDKY NGKPNSPNYK PKDSKFNFRY       120
     LNNGFKIIDG KLRLSIPKQL KEYLKEEYSI TNKFLWIRVP NELLSSNRDI LNSTTRIEFK       180
     PLSDDTYKVI LTYKVDTPTI KEDDGNYLSI DLGINNLMTC YSNQNQESFI IDGGQYLAIN       240
     RYFDKKIKHY QSILNGQGKK TSKRIQNLYK KRRKQLFHLI HSATKKVVNY CVENNISRVI       300
     VGDIKNIRDD ADLGKQNNQK LHKLPFDIIY HQLEYKLNLQ GITLIKKSEK YTSQCSPYSK       360
     KVTKKYANKS NRVKRGLYID KDNNQAFNAD SIGAFNILRK YLQQRRKGPD ITLQVKGLSN       420
     PVKYNWNNHQ FAA                                                          433
//

If you have problems or comments...

PBIL Back to PBIL home page