(data stored in SCRATCH zone)

EMBL: CP002105.PE388

CP002105.PE388       Location/Qualifiers
FT   CDS             425779..427116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0393"
FT                   /product="potassium uptake protein, TrkH family"
FT                   /EC_number="3.6.3.14"
FT                   /note="COGs: COG0168 Trk-type K+ transport systems membrane
FT                   components; InterPro IPR004772:IPR003445; KEGG:
FT                   hor:Hore_11710 potassium uptake protein, TrkH family; PFAM:
FT                   cation transporter; PRIAM: H(+)-transporting two-sector
FT                   ATPase; SPTR: B8CXA2 Potassium uptake protein, TrkH family;
FT                   TIGRFAM: potassium uptake protein, TrkH family; PFAM:
FT                   Cation transport protein; TIGRFAM: potassium uptake
FT                   protein, TrkH family"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11940"
FT                   /db_xref="GOA:D9QUE7"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:D9QUE7"
FT                   /protein_id="ADL11940.1"
FT                   /translation="MRIISFKLDSLSPAQFLALGYIIVITVGALLLMLPAATVDGQGLG
FT                   LINSLFTATSATAVTGLIVVNTGAYFTLFGQAVILLLIQIGGLGFMTTSTLLALILGKR
FT                   INLKKRIIIQEDLNYFNLSGLIRLVQYVTLLTLGVELIGAILLFAPLSVEYSAGKAAFF
FT                   SIFHAVSAFCNAGFDLFGNSLANFTNDVYINLVITALFIIGGIGFAVIADVYRKQRFID
FT                   YSLNTKLVLVITLILIILGTCFVFLLEFSNPATLQGLSFKGKLLAAYFQGVTPRTAGFN
FT                   TIPTGQMRNATLFFIIILMFIGASPGSTGGGLKTTTIGALLAVVYNLVKGNEDIELFER
FT                   RLSQSIIYKALAVTIISLIWIGLVVTVLTITEEANFLSILFETVSAYGTVGLSTGITGG
FT                   LSEAGRIIIILTMFLGRVGPLTLAVAIGERDKEGQMRYPEEKILIG"
     MRIISFKLDS LSPAQFLALG YIIVITVGAL LLMLPAATVD GQGLGLINSL FTATSATAVT        60
     GLIVVNTGAY FTLFGQAVIL LLIQIGGLGF MTTSTLLALI LGKRINLKKR IIIQEDLNYF       120
     NLSGLIRLVQ YVTLLTLGVE LIGAILLFAP LSVEYSAGKA AFFSIFHAVS AFCNAGFDLF       180
     GNSLANFTND VYINLVITAL FIIGGIGFAV IADVYRKQRF IDYSLNTKLV LVITLILIIL       240
     GTCFVFLLEF SNPATLQGLS FKGKLLAAYF QGVTPRTAGF NTIPTGQMRN ATLFFIIILM       300
     FIGASPGSTG GGLKTTTIGA LLAVVYNLVK GNEDIELFER RLSQSIIYKA LAVTIISLIW       360
     IGLVVTVLTI TEEANFLSIL FETVSAYGTV GLSTGITGGL SEAGRIIIIL TMFLGRVGPL       420
     TLAVAIGERD KEGQMRYPEE KILIG                                             445
//

If you have problems or comments...

PBIL Back to PBIL home page