(data stored in SCRATCH zone)

EMBL: CP002105.PE39

CP002105.PE39        Location/Qualifiers
FT   CDS             40532..41407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0039"
FT                   /product="ATPase associated with various cellular
FT                   activities AAA_5"
FT                   /note="COGs: COG0714 MoxR-like ATPase; InterPro
FT                   IPR011704:IPR003593; KEGG: mta:Moth_0825 ATPase; PFAM:
FT                   ATPase associated with various cellular activities AAA_5;
FT                   SMART: AAA ATPase; SPTR: Q2RK97 ATPase associated with
FT                   various cellular activities, AAA_5; PFAM: AAA domain
FT                   (dynein-related subfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11591"
FT                   /db_xref="GOA:D9QSQ3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9QSQ3"
FT                   /protein_id="ADL11591.1"
FT                   /translation="MEITKEELRAGFKEENYICGEEVRIPTYLALKLEKPLLITGEPGV
FT                   GKTEIAKVLSNFFNTELIRLQCYEGLDENKALYEWNYQKQLINIQINKDNKSENLIEED
FT                   IFSEDYLLERPLLKSIKAEKRPVLLIDEIDKTDEEFEAFLFELLSDFQVSIPELGTVAA
FT                   KQKPIVVLTSNANRELSDGLKRRCIFLYIDLPSIEKEVEIIRTKVPGIGDKLSRDIAAA
FT                   ISYLRVNLDLKKKPSISETLDWARALVGLDADRLSPELIQRTRTLFLKNKNDLDSFDEL
FT                   GAKRLIREIN"
     MEITKEELRA GFKEENYICG EEVRIPTYLA LKLEKPLLIT GEPGVGKTEI AKVLSNFFNT        60
     ELIRLQCYEG LDENKALYEW NYQKQLINIQ INKDNKSENL IEEDIFSEDY LLERPLLKSI       120
     KAEKRPVLLI DEIDKTDEEF EAFLFELLSD FQVSIPELGT VAAKQKPIVV LTSNANRELS       180
     DGLKRRCIFL YIDLPSIEKE VEIIRTKVPG IGDKLSRDIA AAISYLRVNL DLKKKPSISE       240
     TLDWARALVG LDADRLSPEL IQRTRTLFLK NKNDLDSFDE LGAKRLIREI N                291
//

If you have problems or comments...

PBIL Back to PBIL home page