(data stored in SCRATCH zone)

EMBL: CP002105.PE391

CP002105.PE391       Location/Qualifiers
FT   CDS             428718..428825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0396"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11943"
FT                   /db_xref="UniProtKB/TrEMBL:D9QUN4"
FT                   /protein_id="ADL11943.1"
FT                   /translation="MVTAAMFWQIFEQTGSIQAYLAYREFLGFNYNQVL"
     MVTAAMFWQI FEQTGSIQAY LAYREFLGFN YNQVL                                   35
//

If you have problems or comments...

PBIL Back to PBIL home page