(data stored in SCRATCH zone)

EMBL: CP002105.PE401

CP002105.PE401       Location/Qualifiers
FT   CDS             448530..449762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0406"
FT                   /product="tyrosyl-tRNA synthetase"
FT                   /EC_number="6.1.1.1"
FT                   /note="COGs: COG0162 Tyrosyl-tRNA synthetase;
FT                   InterProIPR014729:IPR001412:IPR002307:IPR002942:IPR 002305;
FT                   KEGG: hor:Hore_05700 tyrosyl-tRNA synthetase; PFAM:
FT                   aminoacyl-tRNA synthetase class Ib; RNA-binding S4 domain
FT                   protein; SMART: RNA-binding S4 domain protein; SPTR: B8D2A0
FT                   Tyrosyl-tRNA synthetase; TIGRFAM: tyrosyl-tRNA synthetase;
FT                   PFAM: S4 domain; tRNA synthetases class I (W and Y);
FT                   TIGRFAM: tyrosyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11953"
FT                   /db_xref="GOA:D9QUP4"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024108"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:D9QUP4"
FT                   /protein_id="ADL11953.1"
FT                   /translation="MSSESGIEKQLQIIKRGVTELISEDELEDKLKEAQKEDRPLKVKL
FT                   GLDPTAPDIHLGHTVVLQKLKQFQDLGHEVILLIGDFTGRIGDPSGKSKTRPQLTEEEV
FT                   MENAKTYQEQIFKVLDPDKTRLVFNSEWLGEMDFADVLNLSSKYTVARMLEREDFSNRY
FT                   ENNQSIGVHEFFYPLMQGYDSVAIEADVELGGTDQKFNLLVGRRLQKEYGQDPQVILMM
FT                   PLLEGLDGEQKMSKSLGNYIGIDDDPNDMYGKVMSIPDKLLGRYFELLTDVSLEELEEI
FT                   KNGLSSGELHPMETKKRLAETIVAKYYDETTAKKAAREFERVFKDGELPEDIPQVELSS
FT                   DRLEDGELWIVKLVAATGLVDSNSQARRMIKQGAVKIDGEKYDKMNLDLEVEDGMIIQI
FT                   GKKRFAEIILD"
     MSSESGIEKQ LQIIKRGVTE LISEDELEDK LKEAQKEDRP LKVKLGLDPT APDIHLGHTV        60
     VLQKLKQFQD LGHEVILLIG DFTGRIGDPS GKSKTRPQLT EEEVMENAKT YQEQIFKVLD       120
     PDKTRLVFNS EWLGEMDFAD VLNLSSKYTV ARMLEREDFS NRYENNQSIG VHEFFYPLMQ       180
     GYDSVAIEAD VELGGTDQKF NLLVGRRLQK EYGQDPQVIL MMPLLEGLDG EQKMSKSLGN       240
     YIGIDDDPND MYGKVMSIPD KLLGRYFELL TDVSLEELEE IKNGLSSGEL HPMETKKRLA       300
     ETIVAKYYDE TTAKKAAREF ERVFKDGELP EDIPQVELSS DRLEDGELWI VKLVAATGLV       360
     DSNSQARRMI KQGAVKIDGE KYDKMNLDLE VEDGMIIQIG KKRFAEIILD                  410
//

If you have problems or comments...

PBIL Back to PBIL home page