(data stored in SCRATCH zone)

EMBL: CP002105.PE404

CP002105.PE404       Location/Qualifiers
FT   CDS             451137..451406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0409"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11956"
FT                   /db_xref="GOA:D9QUP7"
FT                   /db_xref="UniProtKB/TrEMBL:D9QUP7"
FT                   /protein_id="ADL11956.1"
FT                   /translation="MIFNRKFWTGLTLGGLGGLYLLNYLREKNRQPTKREELEAFADRS
FT                   QQKGKELLTDLISRLDLEAADLQNVDKSELMESLIEMENQNNDR"
     MIFNRKFWTG LTLGGLGGLY LLNYLREKNR QPTKREELEA FADRSQQKGK ELLTDLISRL        60
     DLEAADLQNV DKSELMESLI EMENQNNDR                                          89
//

If you have problems or comments...

PBIL Back to PBIL home page