(data stored in SCRATCH zone)

EMBL: CP002105.PE405

CP002105.PE405       Location/Qualifiers
FT   CDS             451417..452463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0410"
FT                   /product="protein of unknown function UPF0118"
FT                   /note="COGs: COG0628 permease; InterPro IPR002549; KEGG:
FT                   hor:Hore_05740 predicted permease; PFAM: protein of unknown
FT                   function UPF0118; SPTR: B8D2A4 Predicted permease; PFAM:
FT                   Domain of unknown function DUF20"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11957"
FT                   /db_xref="GOA:D9QUP8"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:D9QUP8"
FT                   /protein_id="ADL11957.1"
FT                   /translation="MLDEKRQERKALLLVLLVAIIYFLYLVRIVLLPFVLAIFIVYLVN
FT                   PFVKLLINRGVSRNLALVLIFIIVVGGLFLVGFFAAPPLIEELNALANRIPQYSIEIQK
FT                   IIDSVTQKYQRFKLPSTFQLVVDNAIERIQNIILQFVERTTEVIIGILSRFFSLIMAPI
FT                   LAFYMLKDIETIKKNFWTLIPKESRKDIKQLLKKIDKVLIDYLKGQLLVSVVVGLLSML
FT                   GLYLLDINFYLIIGIFAGIMNLIPYLGVVFGILPAVFVASFKSFQSILEVIVMFAFVQQ
FT                   LEGSLISPKIVGDKVGLHPILIIFSLLVGGELLGIIGMLLAVPVAGIIKVILNHYISRA
FT                   IKINKGES"
     MLDEKRQERK ALLLVLLVAI IYFLYLVRIV LLPFVLAIFI VYLVNPFVKL LINRGVSRNL        60
     ALVLIFIIVV GGLFLVGFFA APPLIEELNA LANRIPQYSI EIQKIIDSVT QKYQRFKLPS       120
     TFQLVVDNAI ERIQNIILQF VERTTEVIIG ILSRFFSLIM APILAFYMLK DIETIKKNFW       180
     TLIPKESRKD IKQLLKKIDK VLIDYLKGQL LVSVVVGLLS MLGLYLLDIN FYLIIGIFAG       240
     IMNLIPYLGV VFGILPAVFV ASFKSFQSIL EVIVMFAFVQ QLEGSLISPK IVGDKVGLHP       300
     ILIIFSLLVG GELLGIIGML LAVPVAGIIK VILNHYISRA IKINKGES                    348
//

If you have problems or comments...

PBIL Back to PBIL home page