(data stored in SCRATCH zone)

EMBL: CP002105.PE41

CP002105.PE41        Location/Qualifiers
FT   CDS             43161..44633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0041"
FT                   /product="inosine-5'-monophosphate dehydrogenase"
FT                   /EC_number="1.1.1.205"
FT                   /note="COGs: COG0516 IMP dehydrogenase/GMP reductase;
FT                   InterProIPR015875:IPR001093:IPR000644:IPR013785:IPR
FT                   005990:IPR018529; KEGG: gwc:GWCH70_0009
FT                   inosine-5'-monophosphate dehydrogenase; PFAM: IMP
FT                   dehydrogenase/GMP reductase; CBS domain containing protein;
FT                   PRIAM: IMP dehydrogenase; SMART: CBS domain containing
FT                   protein; SPTR: C5D335 Inosine-5'-monophosphate
FT                   dehydrogenase; TIGRFAM: inosine-5'-monophosphate
FT                   dehydrogenase; PFAM: CBS domain; IMP dehydrogenase / GMP
FT                   reductase domain; TIGRFAM: inosine-5'-monophosphate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11593"
FT                   /db_xref="GOA:D9QSQ5"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:D9QSQ5"
FT                   /protein_id="ADL11593.1"
FT                   /translation="MENKFEKEGLTFDDVLLIPAKSDVLPKEVDVSTHLTSDIELNTPI
FT                   LSAGMDTVTEAELAIAMAREGGIGIIHKNMSVEQQAEEVDKVKRSESGVIVNPFYLTPD
FT                   NFAYEAEHLMSKFKISGVPIVNNEEDMKLVGIITNRDLRFEKDFDQKLSEVMTKEGLVT
FT                   GPVGTTLEDAEDILQEYKIEKLPLVDDEYRLKGLITIKDIEKAEKYPNAAKDEQGRLLV
FT                   GAAVGTSRDTWSRIEALTDAGVDVIVIDTAHGHSTKVIDLVREIKEEYSKLNLIAGNVA
FT                   TAGATKDLIEAGADAIKVGIGPGSICTTRVVAGVGVPQITAVYDCAKEAEKFGVPVIAD
FT                   GGIKYSGDIVKALAAGASTVMLGSLLAGTKESPGEIEIYKGRSYKVYRGMGSVGAMKEG
FT                   SKDRYFQEEKKKLIPEGVEGRTPYKGELSDTIYQLVGGLRSGMGYCGAEDIETLKEEGK
FT                   FTRITGAGLRESHPHDIEVTKESPNYNLESRE"
     MENKFEKEGL TFDDVLLIPA KSDVLPKEVD VSTHLTSDIE LNTPILSAGM DTVTEAELAI        60
     AMAREGGIGI IHKNMSVEQQ AEEVDKVKRS ESGVIVNPFY LTPDNFAYEA EHLMSKFKIS       120
     GVPIVNNEED MKLVGIITNR DLRFEKDFDQ KLSEVMTKEG LVTGPVGTTL EDAEDILQEY       180
     KIEKLPLVDD EYRLKGLITI KDIEKAEKYP NAAKDEQGRL LVGAAVGTSR DTWSRIEALT       240
     DAGVDVIVID TAHGHSTKVI DLVREIKEEY SKLNLIAGNV ATAGATKDLI EAGADAIKVG       300
     IGPGSICTTR VVAGVGVPQI TAVYDCAKEA EKFGVPVIAD GGIKYSGDIV KALAAGASTV       360
     MLGSLLAGTK ESPGEIEIYK GRSYKVYRGM GSVGAMKEGS KDRYFQEEKK KLIPEGVEGR       420
     TPYKGELSDT IYQLVGGLRS GMGYCGAEDI ETLKEEGKFT RITGAGLRES HPHDIEVTKE       480
     SPNYNLESRE                                                              490
//

If you have problems or comments...

PBIL Back to PBIL home page