(data stored in SCRATCH zone)

EMBL: CP002105.PE417

CP002105.PE417       Location/Qualifiers
FT   CDS             complement(465456..466121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0423"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="InterPro IPR017900:IPR017896:IPR001450; KEGG:
FT                   cce:Ccel_0631 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; SPTR: C4IJ56 Iron-sulfur cluster-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11969"
FT                   /db_xref="GOA:D9QUR0"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D9QUR0"
FT                   /protein_id="ADL11969.1"
FT                   /translation="MRQKGLAGTIGKWSWILIVAFLGIGWKYPVIGSIALVCMLAPAIT
FT                   AAWKGGRIWCGSFCPRGSFNDNLLSKISRSIEIPKFIRTVWFRIGFALFLVYNFVVGII
FT                   NAQGDLIKIGFVFYKIILITSIITVILGIMYHERTWCSFCPMGSLSALITKIRRRWFEQ
FT                   DKRIIVNENTCVDCSVCAKDCPMDLKPHDFVKSNDKDLDCIHCEKCVYNCPVDALTRN"
     MRQKGLAGTI GKWSWILIVA FLGIGWKYPV IGSIALVCML APAITAAWKG GRIWCGSFCP        60
     RGSFNDNLLS KISRSIEIPK FIRTVWFRIG FALFLVYNFV VGIINAQGDL IKIGFVFYKI       120
     ILITSIITVI LGIMYHERTW CSFCPMGSLS ALITKIRRRW FEQDKRIIVN ENTCVDCSVC       180
     AKDCPMDLKP HDFVKSNDKD LDCIHCEKCV YNCPVDALTR N                           221
//

If you have problems or comments...

PBIL Back to PBIL home page