(data stored in SCRATCH zone)

EMBL: CP002105.PE43

CP002105.PE43        Location/Qualifiers
FT   CDS             45413..45868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0043"
FT                   /product="protein of unknown function DUF327"
FT                   /note="COGs: COG1728 conserved hypothetical protein;
FT                   InterPro IPR005585; KEGG: hor:Hore_15530 hypothetical
FT                   protein; PFAM: protein of unknown function DUF327; SPTR:
FT                   C6Q6P9 Putative uncharacterized protein; PFAM: Protein of
FT                   unknown function (DUF327)"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11595"
FT                   /db_xref="InterPro:IPR005585"
FT                   /db_xref="InterPro:IPR024042"
FT                   /db_xref="UniProtKB/TrEMBL:D9QSQ7"
FT                   /protein_id="ADL11595.1"
FT                   /translation="MKIQNDLKKDLNQLLNKSKLQTSESVKSSDNKFLDTLQEVHDANT
FT                   KERLDELLGQIDKQGERLSQKRTFKELVRYKKMVQQFVKEAVEKMYRVKEEFSTYGSGN
FT                   HKVYNLVVKVDESLEELTELVLDKQSTQLEILDRLDEVRGMLVDIYT"
     MKIQNDLKKD LNQLLNKSKL QTSESVKSSD NKFLDTLQEV HDANTKERLD ELLGQIDKQG        60
     ERLSQKRTFK ELVRYKKMVQ QFVKEAVEKM YRVKEEFSTY GSGNHKVYNL VVKVDESLEE       120
     LTELVLDKQS TQLEILDRLD EVRGMLVDIY T                                      151
//

If you have problems or comments...

PBIL Back to PBIL home page