(data stored in SCRATCH zone)

EMBL: CP002105.PE434

CP002105.PE434       Location/Qualifiers
FT   CDS             479477..479668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11986"
FT                   /db_xref="UniProtKB/TrEMBL:D9QUS7"
FT                   /protein_id="ADL11986.1"
FT                   /translation="MGEGELRVFKYNEGDKDELQELIVNKKRELDRKEKALSRIDSKVV
FT                   NSKLEKSTGLFKALKSFR"
     MGEGELRVFK YNEGDKDELQ ELIVNKKREL DRKEKALSRI DSKVVNSKLE KSTGLFKALK        60
     SFR                                                                      63
//

If you have problems or comments...

PBIL Back to PBIL home page