(data stored in SCRATCH zone)

EMBL: CP002105.PE435

CP002105.PE435       Location/Qualifiers
FT   CDS             479842..481626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0441"
FT                   /product="PAS modulated sigma54 specific transcriptional
FT                   regulator, Fis family"
FT                   /note="COGs: COG3829 Transcriptional regulator containing
FT                   PAS AAA-type ATPase and DNA-binding domains;
FT                   InterProIPR002078:IPR009057:IPR000014:IPR003593:IPR
FT                   013767:IPR002197; KEGG: amt:Amet_4666 sigma-54 dependent
FT                   trancsriptional regulator; PFAM: sigma-54 factor
FT                   interaction domain-containing protein; PAS fold domain
FT                   protein; helix-turn-helix Fis-type; SMART: AAA ATPase; PAS
FT                   domain containing protein; SPTR: A6TX18 Sigma54 specific
FT                   transcriptional regulator, Fis family; PFAM: Bacterial
FT                   regulatory protein, Fis family; Sigma-54 interaction
FT                   domain; PAS fold; TIGRFAM: PAS domain S-box"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11987"
FT                   /db_xref="GOA:D9QUS8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR039472"
FT                   /db_xref="UniProtKB/TrEMBL:D9QUS8"
FT                   /protein_id="ADL11987.1"
FT                   /translation="MTKLKELKKFIQQIANAFAAVMDYEIGILDDEVEIVAGTGKYKEI
FT                   VNSRVGSGCITDRLISNSNSKSFFVEDTDSNDLCNRCQFKKECPVLAVVISPIKFSGQV
FT                   VGTFALMAFDETQRQNLITNRSNLITFSEKVADFLSSTLAEKEMRKQMGILADQFKAVI
FT                   NSVHEGIIAINAQGNITHINQSATEVLKLNQVQTGKNIKSFFPELNLERIFSDSIMKND
FT                   YCETKLKYKQGEEEFELLCNITLIKNNEQVIGATISFRGLEEMKQLATKIIAEDQQSAF
FT                   DKIKGTSNEIINLKKQMHKVAQTSSTVLICGESGTGKGMFARAIHEESDRKEEAFISVN
FT                   CAAIPENLLESELFGYEEGAFTGAKKGGKPGKFELAHKGTIFLDEIGDMPLHFQVKLLK
FT                   VIEDKKLERVGGVESIDIDVRIIAATHQDLKKMVKEGKFRKDLFYRLNVIPFSIPPLRE
FT                   RKEDILLLSHFFLQRYSHLLGKDIEGFTEGAKQKLLNYSWPGNIRELENSIEYAVNIAT
FT                   SNYITEKYLPETILESFSGNEETSVVPTLNEVERKTIIKALQEFGTSGKGKEKAAEALG
FT                   IGRSTLYRKLDDYNIELS"
     MTKLKELKKF IQQIANAFAA VMDYEIGILD DEVEIVAGTG KYKEIVNSRV GSGCITDRLI        60
     SNSNSKSFFV EDTDSNDLCN RCQFKKECPV LAVVISPIKF SGQVVGTFAL MAFDETQRQN       120
     LITNRSNLIT FSEKVADFLS STLAEKEMRK QMGILADQFK AVINSVHEGI IAINAQGNIT       180
     HINQSATEVL KLNQVQTGKN IKSFFPELNL ERIFSDSIMK NDYCETKLKY KQGEEEFELL       240
     CNITLIKNNE QVIGATISFR GLEEMKQLAT KIIAEDQQSA FDKIKGTSNE IINLKKQMHK       300
     VAQTSSTVLI CGESGTGKGM FARAIHEESD RKEEAFISVN CAAIPENLLE SELFGYEEGA       360
     FTGAKKGGKP GKFELAHKGT IFLDEIGDMP LHFQVKLLKV IEDKKLERVG GVESIDIDVR       420
     IIAATHQDLK KMVKEGKFRK DLFYRLNVIP FSIPPLRERK EDILLLSHFF LQRYSHLLGK       480
     DIEGFTEGAK QKLLNYSWPG NIRELENSIE YAVNIATSNY ITEKYLPETI LESFSGNEET       540
     SVVPTLNEVE RKTIIKALQE FGTSGKGKEK AAEALGIGRS TLYRKLDDYN IELS             594
//

If you have problems or comments...

PBIL Back to PBIL home page