(data stored in SCRATCH zone)

EMBL: CP002105.PE436

CP002105.PE436       Location/Qualifiers
FT   CDS             482013..483416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0442"
FT                   /product="trimethylamine methyltransferase"
FT                   /note="COGs: COG5598 Trimethylamine:corrinoid
FT                   methyltransferase; InterPro IPR010426; KEGG: dsy:DSY3648
FT                   hypothetical protein; PFAM: trimethylamine
FT                   methyltransferase; SPTR: Q24MI3 Trimethylamine
FT                   methyltransferase mttB; PFAM: Trimethylamine
FT                   methyltransferase (MTTB)"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11988"
FT                   /db_xref="GOA:D9QUS9"
FT                   /db_xref="InterPro:IPR010426"
FT                   /db_xref="InterPro:IPR038601"
FT                   /db_xref="UniProtKB/TrEMBL:D9QUS9"
FT                   /protein_id="ADL11988.1"
FT                   /translation="MRPKLNFFSEEEIERIHNMSLDILESMGMKIPSEEALGILEEAGA
FT                   DIDGEIAKFTPELIENAVETAPKRDELTLYARDEEYDINLSEDAPVLAGMTQATNVIDV
FT                   DTREKRPATNEDVGLMLRVLDQLDNVSIASTLATPQDVPEERMDQYTWATAIKNTKKHI
FT                   TAPSFNDQCVKDAVKMGSIAVGGEDKFQERPFFSTWVLTSPPLELDAETASTLMEASRH
FT                   NIPTLVSSGPILGVSAPVTIAGGVAQAHAENMACLVLSQAVNPGAPFIYTSFARIMDMK
FT                   VTNISMASPEFAIMKGCMAELGHLLDLPTRMPSMLRDSKKVDAQAGFEVGMGLVGALES
FT                   EIIGGLQLDMDIVIDFADLVFSNECMGQLKRIARGVEVNDNNLARELISEVGHGGDFLK
FT                   TLHTAQNFKDELWDADLVERRMWEYWEDDGCLDMEERALARVKEMIEEDTGPLLDEELQ
FT                   KEIDAIAKD"
     MRPKLNFFSE EEIERIHNMS LDILESMGMK IPSEEALGIL EEAGADIDGE IAKFTPELIE        60
     NAVETAPKRD ELTLYARDEE YDINLSEDAP VLAGMTQATN VIDVDTREKR PATNEDVGLM       120
     LRVLDQLDNV SIASTLATPQ DVPEERMDQY TWATAIKNTK KHITAPSFND QCVKDAVKMG       180
     SIAVGGEDKF QERPFFSTWV LTSPPLELDA ETASTLMEAS RHNIPTLVSS GPILGVSAPV       240
     TIAGGVAQAH AENMACLVLS QAVNPGAPFI YTSFARIMDM KVTNISMASP EFAIMKGCMA       300
     ELGHLLDLPT RMPSMLRDSK KVDAQAGFEV GMGLVGALES EIIGGLQLDM DIVIDFADLV       360
     FSNECMGQLK RIARGVEVND NNLARELISE VGHGGDFLKT LHTAQNFKDE LWDADLVERR       420
     MWEYWEDDGC LDMEERALAR VKEMIEEDTG PLLDEELQKE IDAIAKD                     467
//

If you have problems or comments...

PBIL Back to PBIL home page