(data stored in SCRATCH zone)

EMBL: CP002105.PE44

CP002105.PE44        Location/Qualifiers
FT   CDS             45897..46886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0044"
FT                   /product="DNA polymerase III, delta prime subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="COGs: COG2812 DNA polymerase III gamma/tau subunits;
FT                   InterPro IPR008921:IPR004622; KEGG: hor:Hore_20360 DNA
FT                   polymerase III, delta prime subunit; PRIAM: DNA-directed
FT                   DNA polymerase; SPTR: B8CZS9 DNA polymerase III, delta
FT                   prime subunit; TIGRFAM: DNA polymerase III, delta prime
FT                   subunit; TIGRFAM: DNA polymerase III, delta' subunit; DNA
FT                   polymerase III, subunits gamma and tau"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11596"
FT                   /db_xref="GOA:D9QSQ8"
FT                   /db_xref="InterPro:IPR004622"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR015199"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9QSQ8"
FT                   /protein_id="ADL11596.1"
FT                   /translation="MAFGDVVGQDTPIDILQNGLKRDRVNHAYLFAGKKGVGKEFTAVQ
FT                   FAKALNCKERKSDACGECISCRKFNSGNHPDIVNIEPEGKYIKIDQIRSLQQNTSYKPY
FT                   ESEWKIYIIKQADRMNLQAANGLLRTLEEPPKYVVIILLASKEDLLLPTITSRCQIIKF
FT                   RTLTVDEITDRLISRFELDRAEAEKIAILADGSLGKAIEFIENEDTLTTREIILDELKE
FT                   LNGLDIVEVFELVQKILDYKEEIDGILESIITFYRDLLLYKGSQKEELLINFDYQEEVI
FT                   KLSREYTFDELQSIIEEIEQTNNLVQNTNVKLQLALEVMLLNIKEKRV"
     MAFGDVVGQD TPIDILQNGL KRDRVNHAYL FAGKKGVGKE FTAVQFAKAL NCKERKSDAC        60
     GECISCRKFN SGNHPDIVNI EPEGKYIKID QIRSLQQNTS YKPYESEWKI YIIKQADRMN       120
     LQAANGLLRT LEEPPKYVVI ILLASKEDLL LPTITSRCQI IKFRTLTVDE ITDRLISRFE       180
     LDRAEAEKIA ILADGSLGKA IEFIENEDTL TTREIILDEL KELNGLDIVE VFELVQKILD       240
     YKEEIDGILE SIITFYRDLL LYKGSQKEEL LINFDYQEEV IKLSREYTFD ELQSIIEEIE       300
     QTNNLVQNTN VKLQLALEVM LLNIKEKRV                                         329
//

If you have problems or comments...

PBIL Back to PBIL home page