(data stored in SCRATCH zone)

EMBL: CP002105.PE46

CP002105.PE46        Location/Qualifiers
FT   CDS             47911..48261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0046"
FT                   /product="protein of unknown function DUF972"
FT                   /note="COGs: COG4467 conserved hypothetical protein;
FT                   InterPro IPR010377; KEGG: hor:Hore_20340 hypothetical
FT                   protein; PFAM: protein of unknown function DUF972; SPTR:
FT                   B8CZS7 Uncharacterized protein conserved in bacteria; PFAM:
FT                   Protein of unknown function (DUF972)"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11598"
FT                   /db_xref="GOA:D9QSR0"
FT                   /db_xref="InterPro:IPR010377"
FT                   /db_xref="UniProtKB/TrEMBL:D9QSR0"
FT                   /protein_id="ADL11598.1"
FT                   /translation="MEEILSLLATFQEKLNMLNDDFQKIKKITHRLYKENEELKEENEN
FT                   LKRLLFEQKAENEEEPEAREGYNNLAKLYEEGFHICHLNFGEKRDGECLFCMGLLDIQL
FT                   DSEVEADKVVQD"
     MEEILSLLAT FQEKLNMLND DFQKIKKITH RLYKENEELK EENENLKRLL FEQKAENEEE        60
     PEAREGYNNL AKLYEEGFHI CHLNFGEKRD GECLFCMGLL DIQLDSEVEA DKVVQD           116
//

If you have problems or comments...

PBIL Back to PBIL home page