(data stored in SCRATCH zone)

EMBL: CP002105.PE461

CP002105.PE461       Location/Qualifiers
FT   CDS             509590..510360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0467"
FT                   /product="sulfurylase large subunit, molybdopterin cytosine
FT                   dinucleotide biosynthesis"
FT                   /note="COGs: COG1975 Xanthine and CO dehydrogenase
FT                   maturation factor XdhC/CoxF family; KEGG: mta:Moth_2006
FT                   sulfurylase large subunit, molybdopterin cytosine
FT                   dinucleotide biosynthesis; SPTR: Q2RGY7 Predicted
FT                   sulfurylase large subunit, molybdopterin cytosine
FT                   dinucleotide biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ADL12013"
FT                   /db_xref="InterPro:IPR027051"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D9QUV4"
FT                   /protein_id="ADL12013.1"
FT                   /translation="MEQIEFYRKIATAYKQKEQAMIGTITAVKENNNFEFDPVGSKILL
FT                   RQEDRLAYPANSLELWQIILDNIDAADQLIDLKQPALNKVEIDSGSEMEVYFEPVIEEP
FT                   RLLIFGAGHVAQSLAQVSKMADFKVTVMDDREDMVNRQRYPQADKLVCAEFDEYLENVQ
FT                   IKENDYLVIVTRGHQHDYDVLREVIDSKARYIGMIGSSRKVKILFKNLQEKEGISQELI
FT                   DKVYAPIGVDIASETPAEIAISIIAEIISIRRGK"
     MEQIEFYRKI ATAYKQKEQA MIGTITAVKE NNNFEFDPVG SKILLRQEDR LAYPANSLEL        60
     WQIILDNIDA ADQLIDLKQP ALNKVEIDSG SEMEVYFEPV IEEPRLLIFG AGHVAQSLAQ       120
     VSKMADFKVT VMDDREDMVN RQRYPQADKL VCAEFDEYLE NVQIKENDYL VIVTRGHQHD       180
     YDVLREVIDS KARYIGMIGS SRKVKILFKN LQEKEGISQE LIDKVYAPIG VDIASETPAE       240
     IAISIIAEII SIRRGK                                                       256
//

If you have problems or comments...

PBIL Back to PBIL home page