(data stored in SCRATCH zone)

EMBL: CP002105.PE47

CP002105.PE47        Location/Qualifiers
FT   CDS             48248..49018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0047"
FT                   /product="Methyltransferase type 11"
FT                   /note="COGs: COG4123 O-methyltransferase; InterPro
FT                   IPR002052:IPR013216; KEGG: cpy:Cphy_3911 methyltransferase
FT                   type 11; PFAM: Methyltransferase type 11; SPTR: C6LAP7
FT                   Putative N-6 adenine-specific DNA methylase; PFAM:
FT                   Methyltransferase small domain"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11599"
FT                   /db_xref="GOA:D9QSR1"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D9QSR1"
FT                   /protein_id="ADL11599.1"
FT                   /translation="MSRIELKKDERLDDLIHSNLQIIQSSNHFAFAIDAVLLADFVEIK
FT                   PKDRVIDLGTGTGVIPLLLTGKNDPDQIVGIEIQVKLAEMAQRSVLYNKLEDVIEIKKA
FT                   DIRQLKEVFAAESFDVVVSNPPYLPLGQGKVNPDSSIALARHELKVKLEDVVEISSYLV
FT                   RYKGRVSYIYRVERLDELLEVMNYYNLQPKYMRLIQPEGDKACNLVLVTGIKGANSGLE
FT                   VDKPLIIYRDNGEYTEEVLKIYYGEDYNYKGKGS"
     MSRIELKKDE RLDDLIHSNL QIIQSSNHFA FAIDAVLLAD FVEIKPKDRV IDLGTGTGVI        60
     PLLLTGKNDP DQIVGIEIQV KLAEMAQRSV LYNKLEDVIE IKKADIRQLK EVFAAESFDV       120
     VVSNPPYLPL GQGKVNPDSS IALARHELKV KLEDVVEISS YLVRYKGRVS YIYRVERLDE       180
     LLEVMNYYNL QPKYMRLIQP EGDKACNLVL VTGIKGANSG LEVDKPLIIY RDNGEYTEEV       240
     LKIYYGEDYN YKGKGS                                                       256
//

If you have problems or comments...

PBIL Back to PBIL home page