(data stored in SCRATCH zone)

EMBL: CP002105.PE470

CP002105.PE470       Location/Qualifiers
FT   CDS             515883..516218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0476"
FT                   /product="putative transcriptional regulator, ModE family"
FT                   /note="COGs: COG2005 N-terminal domain of
FT                   molybdenum-binding protein; InterPro IPR011991:IPR000847;
FT                   KEGG: nth:Nther_2202 putative transcriptional regulator,
FT                   ModE family; PFAM: regulatory protein LysR; SPTR: B2A7Z6
FT                   Putative transcriptional regulator, ModE family; PFAM:
FT                   Bacterial regulatory helix-turn-helix protein, lysR family;
FT                   TIGRFAM: ModE molybdate transport repressor domain"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ADL12022"
FT                   /db_xref="GOA:D9QUW3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9QUW3"
FT                   /protein_id="ADL12022.1"
FT                   /translation="MEIKWKIWLEEDDGKVFGDGPRELLSKVKELGSLRQAAKAMDMSY
FT                   SKAWSIISMIEKNLDVELLQRQIGGSNGGGSELTEEGKEILIKYHKMEQEVDHTLQKIF
FT                   QNFFNCC"
     MEIKWKIWLE EDDGKVFGDG PRELLSKVKE LGSLRQAAKA MDMSYSKAWS IISMIEKNLD        60
     VELLQRQIGG SNGGGSELTE EGKEILIKYH KMEQEVDHTL QKIFQNFFNC C                111
//

If you have problems or comments...

PBIL Back to PBIL home page