(data stored in SCRATCH zone)

EMBL: CP002105.PE484

CP002105.PE484       Location/Qualifiers
FT   CDS             533249..533692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0490"
FT                   /product="protein of unknown function DUF1445"
FT                   /note="COGs: COG4336 conserved hypothetical protein;
FT                   InterPro IPR009906; KEGG: tpd:Teth39_1160 hypothetical
FT                   protein; PFAM: protein of unknown function DUF1445; SPTR:
FT                   C7HK72 Putative uncharacterized protein; PFAM: Protein of
FT                   unknown function (DUF1445)"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ADL12036"
FT                   /db_xref="GOA:D9QUX7"
FT                   /db_xref="InterPro:IPR009906"
FT                   /db_xref="InterPro:IPR038021"
FT                   /db_xref="UniProtKB/TrEMBL:D9QUX7"
FT                   /protein_id="ADL12036.1"
FT                   /translation="MKLGISMPSSSQENIPIRHIEAGKNVPMYITNKQCKTAGKFKGPM
FT                   VVSMRPIPSDLITDTIQITAKYKTVHGTPVQVGSPEKLGIENINTPDFGDSVKIKADEI
FT                   PVFWACGVTPQAVAMKVKLSIMITHSPGHMFITDLENKELKNY"
     MKLGISMPSS SQENIPIRHI EAGKNVPMYI TNKQCKTAGK FKGPMVVSMR PIPSDLITDT        60
     IQITAKYKTV HGTPVQVGSP EKLGIENINT PDFGDSVKIK ADEIPVFWAC GVTPQAVAMK       120
     VKLSIMITHS PGHMFITDLE NKELKNY                                           147
//

If you have problems or comments...

PBIL Back to PBIL home page