(data stored in SCRATCH zone)

EMBL: CP002105.PE496

CP002105.PE496       Location/Qualifiers
FT   CDS             545675..548011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0502"
FT                   /product="ATP-dependent proteinase"
FT                   /EC_number="3.4.21.53"
FT                   /note="COGs: COG0466 ATP-dependent Lon protease;
FT                   InterProIPR008268:IPR001984:IPR020568:IPR003111:IPR
FT                   003593:IPR004815:IPR003959:IPR008269; KEGG: hor:Hore_14910
FT                   ATP-dependent protease La; PFAM: peptidase S16 lon domain
FT                   protein; AAA ATPase central domain protein; PRIAM:
FT                   Endopeptidase La; SMART: peptidase S16 lon domain protein;
FT                   AAA ATPase; SPTR: B8CY71 ATP-dependent protease La;
FT                   TIGRFAM: ATP-dependent protease La; PFAM: ATP-dependent
FT                   protease La (LON) domain; ATPase family associated with
FT                   various cellular activities (AAA); Lon protease (S16)
FT                   C-terminal proteolytic domain; TIGRFAM: ATP-dependent
FT                   protease La"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ADL12048"
FT                   /db_xref="GOA:D9QUY9"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004815"
FT                   /db_xref="InterPro:IPR008268"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027543"
FT                   /db_xref="UniProtKB/TrEMBL:D9QUY9"
FT                   /protein_id="ADL12048.1"
FT                   /translation="MVEEIDTTEIKDELPLLVLRGLVVFPHMVIPLLVGRDKSVEALEE
FT                   AMVEDRLILLAAQKDETVEEPETEEIYDMGTVAQVKQLVKLPDGTIKILVEGLKRAKID
FT                   EFLQEDPYFKIRLQEIEPEEKESKELEALMRSLVNRFEEYVKLNQKLPPETMMTVANVE
FT                   DPGRLVDVMVSHMSLKVDQEQEILQAVSYKERLKQLYKLLDEEIEVLEVKDKINSEVRE
FT                   QVEKRQKEYYLKEQLKAIKKELGQDEEMSDEIEEYRTKIEEADLPEEVEEKALKEVDRL
FT                   TRMPPMANEGVVVRNYLDCILDLPWNEKSQDRLVLDDAEEILERDHYGLEDVKDRILEY
FT                   LAVRKLTDEMKSPILCLVGPPGVGKTSLGKSLAEAIGREFVRLSLGGLKDEAEIRGHRR
FT                   TYVGSRPGRIINAIRDAGTNNPLFLLDEVDKIQSDFRGDPAAALLEVLDPEQNDTFTDH
FT                   YLELPFDLSDVIFITTANVTHTIPGPLQDRMEVIEIAGYTEEDKVKIAQEHLLPKQIEN
FT                   HGLSEDQINVSENAIRKLIRNYTRESGVRNLERKLAGVCRKVAKEVVKGKERLSRVTVQ
FT                   NVDSYLGIEKFNYGEVDEESQVGVATGLAWTKSGGDILKIEVSVVPGKGKLLLTGKLGD
FT                   VMKESGQAALSYARSKIEEFELEEDFHENYDIHIHVPKGAIPKDGPSAGITITTAIISA
FT                   LSGRKVNSKVAMTGEITLRGRVLPVGGVESKVLAAHRAGIETVIMSEENEKNLDEVPDN
FT                   IKRDLEFKFVEHMDEVTDTALLKEE"
     MVEEIDTTEI KDELPLLVLR GLVVFPHMVI PLLVGRDKSV EALEEAMVED RLILLAAQKD        60
     ETVEEPETEE IYDMGTVAQV KQLVKLPDGT IKILVEGLKR AKIDEFLQED PYFKIRLQEI       120
     EPEEKESKEL EALMRSLVNR FEEYVKLNQK LPPETMMTVA NVEDPGRLVD VMVSHMSLKV       180
     DQEQEILQAV SYKERLKQLY KLLDEEIEVL EVKDKINSEV REQVEKRQKE YYLKEQLKAI       240
     KKELGQDEEM SDEIEEYRTK IEEADLPEEV EEKALKEVDR LTRMPPMANE GVVVRNYLDC       300
     ILDLPWNEKS QDRLVLDDAE EILERDHYGL EDVKDRILEY LAVRKLTDEM KSPILCLVGP       360
     PGVGKTSLGK SLAEAIGREF VRLSLGGLKD EAEIRGHRRT YVGSRPGRII NAIRDAGTNN       420
     PLFLLDEVDK IQSDFRGDPA AALLEVLDPE QNDTFTDHYL ELPFDLSDVI FITTANVTHT       480
     IPGPLQDRME VIEIAGYTEE DKVKIAQEHL LPKQIENHGL SEDQINVSEN AIRKLIRNYT       540
     RESGVRNLER KLAGVCRKVA KEVVKGKERL SRVTVQNVDS YLGIEKFNYG EVDEESQVGV       600
     ATGLAWTKSG GDILKIEVSV VPGKGKLLLT GKLGDVMKES GQAALSYARS KIEEFELEED       660
     FHENYDIHIH VPKGAIPKDG PSAGITITTA IISALSGRKV NSKVAMTGEI TLRGRVLPVG       720
     GVESKVLAAH RAGIETVIMS EENEKNLDEV PDNIKRDLEF KFVEHMDEVT DTALLKEE         778
//

If you have problems or comments...

PBIL Back to PBIL home page