(data stored in SCRATCH zone)

EMBL: CP002105.PE497

CP002105.PE497       Location/Qualifiers
FT   CDS             548014..548598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0503"
FT                   /product="ribosome biogenesis GTP-binding protein YsxC"
FT                   /note="COGs: COG0218 GTPase; InterPro
FT                   IPR019987:IPR005225:IPR002917; KEGG: lrf:LAR_0631
FT                   GTP-binding protein; PFAM: GTP-binding protein
FT                   HSR1-related; SPTR: C7XTP6 Ribosome biogenesis GTP-binding
FT                   protein YsxC; TIGRFAM: ribosome biogenesis GTP-binding
FT                   protein YsxC; small GTP-binding protein; PFAM: GTPase of
FT                   unknown function; TIGRFAM: ribosome biogenesis GTP-binding
FT                   protein YsxC/EngB; small GTP-binding protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ADL12049"
FT                   /db_xref="GOA:D9QUZ0"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/TrEMBL:D9QUZ0"
FT                   /protein_id="ADL12049.1"
FT                   /translation="MNLNNVKYLCSATSPADYPRHNLPEIALAGRSNVGKSSLINQMVN
FT                   RNRFAHTSSKPGKTQTLNFYNIDNIFSFVDLPGYGFARVPDEVKDKWSEMIEEYLFHRS
FT                   NLAGVILIVDARHEPTDDDLMMYEWLLEMQLPHLVVGTKVDKLSNSQLKPNRKQIFDKL
FT                   RLEPQTPFTYFSAEEGTGKNEVWSFIKEITS"
     MNLNNVKYLC SATSPADYPR HNLPEIALAG RSNVGKSSLI NQMVNRNRFA HTSSKPGKTQ        60
     TLNFYNIDNI FSFVDLPGYG FARVPDEVKD KWSEMIEEYL FHRSNLAGVI LIVDARHEPT       120
     DDDLMMYEWL LEMQLPHLVV GTKVDKLSNS QLKPNRKQIF DKLRLEPQTP FTYFSAEEGT       180
     GKNEVWSFIK EITS                                                         194
//

If you have problems or comments...

PBIL Back to PBIL home page