(data stored in SCRATCH zone)

EMBL: CP002105.PE51

CP002105.PE51        Location/Qualifiers
FT   CDS             50632..51624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0051"
FT                   /product="NurA domain protein"
FT                   /note="InterPro IPR018977; KEGG: bha:BH0051 hypothetical
FT                   protein; PFAM: NurA domain; SPTR: Q9KGL0 BH0051 protein;
FT                   PFAM: NurA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11603"
FT                   /db_xref="InterPro:IPR018977"
FT                   /db_xref="UniProtKB/TrEMBL:D9QSR5"
FT                   /protein_id="ADL11603.1"
FT                   /translation="MLEVSAKLKEDLTNANQELQQKYSKKSGLNKQDLRAKIKQKLSGI
FT                   IKLNQMSEDSLEAWTDNRVIVGVDGSVNKLGSNYPHYLCLLQALAKSTAKEDIIETELF
FT                   CPLVSSSKEEINKFILDQQQQGNTGISKQYAANKIKISKLAELELEVALQAIKEWQPKL
FT                   IMLDGSLIRYRIEAEEKWSELKETAISQEILLVGVIEEIGTQEVGKEVDEELAEFYDRE
FT                   LLFGVLNRGEMLTLEFKRSLKTVFLRTSRDPQVIGLDILEEQQSELQNMAELIYTLTPE
FT                   DSRGIPIWLDVVDHEVRISDKMMESLIDAYLDSSLKKRLFASKREERVY"
     MLEVSAKLKE DLTNANQELQ QKYSKKSGLN KQDLRAKIKQ KLSGIIKLNQ MSEDSLEAWT        60
     DNRVIVGVDG SVNKLGSNYP HYLCLLQALA KSTAKEDIIE TELFCPLVSS SKEEINKFIL       120
     DQQQQGNTGI SKQYAANKIK ISKLAELELE VALQAIKEWQ PKLIMLDGSL IRYRIEAEEK       180
     WSELKETAIS QEILLVGVIE EIGTQEVGKE VDEELAEFYD RELLFGVLNR GEMLTLEFKR       240
     SLKTVFLRTS RDPQVIGLDI LEEQQSELQN MAELIYTLTP EDSRGIPIWL DVVDHEVRIS       300
     DKMMESLIDA YLDSSLKKRL FASKREERVY                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page