(data stored in SCRATCH zone)

EMBL: CP002105.PE52

CP002105.PE52        Location/Qualifiers
FT   CDS             52134..53990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0052"
FT                   /product="protein of unknown function DUF87"
FT                   /note="COGs: COG0433 ATPase; InterPro IPR002789; KEGG:
FT                   bcl:ABC0060 hypothetical protein; PFAM: protein of unknown
FT                   function DUF87; SPTR: Q5WLX2 Putative uncharacterized
FT                   protein; PFAM: Domain of unknown function DUF87"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11604"
FT                   /db_xref="InterPro:IPR002789"
FT                   /db_xref="InterPro:IPR008571"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9QSR6"
FT                   /protein_id="ADL11604.1"
FT                   /translation="MQVVGLTTQQEVYVASKERKFRSNEILKILDSELDNPLGEVIETQ
FT                   SYNRFIPLSIEDSFVDKGVIESLRSIGYNIDEDEINIAKVRLLTEAIYPVKTGAAVEIP
FT                   EFDEVKDLMIKEEPDQGLVLGIIRGTEEMTAEMDDKLQNIAPLLEDDEITSQEGIPFNF
FT                   KLRAMHQYPHIGIFGGSGSGKSFGMRVMLEELMKLEVPTLVFDPHFEMDFSEDFAGLPE
FT                   EYKVDFDDRFEIFQVGQDVGVNFEDLSTKDLTELLSAASDLSESMSNVVESLHNTKGKR
FT                   DSLLTFKNRLHDLQEAMNEGKNKIQRRLRSGELSGQNKEQYQDYLGLLEDYGSLHLSSI
FT                   NGVIWRLNRLERDGLFRQSITDIEDALKRRQSVVIQGTIRLLQVFSTYLLGNLYRQRRD
FT                   YKDADYRGETADYFPPFVIATDEAHNFAPKGYESPAKRILKQISQEGRKYGTFLILATQ
FT                   RPTLLEETVTAQLNTKFVFRTVRASDIEIIKQETDLTAEEAKRLPYLRSGDAFMSSAIF
FT                   GRTMPIRIRVAKTTSPHTENPFDELEAKTEADQEEFYNLIADQLPIHDSDLLTPLKEVN
FT                   KRLDGGVLNVNSLQDRLENLAAKGKIEKEESVLGDVTYNLEK"
     MQVVGLTTQQ EVYVASKERK FRSNEILKIL DSELDNPLGE VIETQSYNRF IPLSIEDSFV        60
     DKGVIESLRS IGYNIDEDEI NIAKVRLLTE AIYPVKTGAA VEIPEFDEVK DLMIKEEPDQ       120
     GLVLGIIRGT EEMTAEMDDK LQNIAPLLED DEITSQEGIP FNFKLRAMHQ YPHIGIFGGS       180
     GSGKSFGMRV MLEELMKLEV PTLVFDPHFE MDFSEDFAGL PEEYKVDFDD RFEIFQVGQD       240
     VGVNFEDLST KDLTELLSAA SDLSESMSNV VESLHNTKGK RDSLLTFKNR LHDLQEAMNE       300
     GKNKIQRRLR SGELSGQNKE QYQDYLGLLE DYGSLHLSSI NGVIWRLNRL ERDGLFRQSI       360
     TDIEDALKRR QSVVIQGTIR LLQVFSTYLL GNLYRQRRDY KDADYRGETA DYFPPFVIAT       420
     DEAHNFAPKG YESPAKRILK QISQEGRKYG TFLILATQRP TLLEETVTAQ LNTKFVFRTV       480
     RASDIEIIKQ ETDLTAEEAK RLPYLRSGDA FMSSAIFGRT MPIRIRVAKT TSPHTENPFD       540
     ELEAKTEADQ EEFYNLIADQ LPIHDSDLLT PLKEVNKRLD GGVLNVNSLQ DRLENLAAKG       600
     KIEKEESVLG DVTYNLEK                                                     618
//

If you have problems or comments...

PBIL Back to PBIL home page