(data stored in SCRATCH zone)

EMBL: CP002105.PE58

CP002105.PE58        Location/Qualifiers
FT   CDS             59726..59992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0059"
FT                   /product="protein of unknown function DUF1021"
FT                   /note="COGs: COG4466 Uncharacterized protein; InterPro
FT                   IPR009366; KEGG: hor:Hore_21690 hypothetical protein; PFAM:
FT                   protein of unknown function DUF1021; SPTR: B8D0H9
FT                   Uncharacterized protein conserved in bacteria; PFAM:
FT                   Protein of unknown function (DUF1021)"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11610"
FT                   /db_xref="GOA:D9QSS2"
FT                   /db_xref="InterPro:IPR009366"
FT                   /db_xref="UniProtKB/TrEMBL:D9QSS2"
FT                   /protein_id="ADL11610.1"
FT                   /translation="MGDNILEQIKSDLESFVGKEVSLKANQGRRKIIKKEGVLEETYSN
FT                   VFVVKVEEDRAPRKVSYSYADILTETVEVQIKNNNTKIGCVSV"
     MGDNILEQIK SDLESFVGKE VSLKANQGRR KIIKKEGVLE ETYSNVFVVK VEEDRAPRKV        60
     SYSYADILTE TVEVQIKNNN TKIGCVSV                                           88
//

If you have problems or comments...

PBIL Back to PBIL home page