(data stored in SCRATCH zone)

EMBL: CP002105.PE6

CP002105.PE6         Location/Qualifiers
FT   CDS             5325..5582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0006"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hor:Hore_00050 hypothetical protein; SPTR:
FT                   B8CZN8 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11558"
FT                   /db_xref="InterPro:IPR007169"
FT                   /db_xref="UniProtKB/TrEMBL:D9QSA2"
FT                   /protein_id="ADL11558.1"
FT                   /translation="MLLHLGNDYMIPTKDVVMIADIESTDSEITREFLEVAKEEGFIKN
FT                   FSKGEPKSFVLTNETIYYSNISSKTLRKRMNYVNRLSRDY"
     MLLHLGNDYM IPTKDVVMIA DIESTDSEIT REFLEVAKEE GFIKNFSKGE PKSFVLTNET        60
     IYYSNISSKT LRKRMNYVNR LSRDY                                              85
//

If you have problems or comments...

PBIL Back to PBIL home page