(data stored in SCRATCH zone)

EMBL: CP002105.PE71

CP002105.PE71        Location/Qualifiers
FT   CDS             74720..76024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0072"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hor:Hore_21430 hypothetical protein; SPTR:
FT                   B8D0F2 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11623"
FT                   /db_xref="InterPro:IPR024300"
FT                   /db_xref="UniProtKB/TrEMBL:D9QST5"
FT                   /protein_id="ADL11623.1"
FT                   /translation="MSNFEQQVNLKRLELDRTVNKIKDIKAEVEAVESKVREGKIIFSG
FT                   VVAEDIIYVGQEGIIYHQFEELDFSICLPVEKESEDQEVELTPWIEYLDFQLADEGKHL
FT                   EQKIMLKVHTLLMKESQLKVKPGAADTYRVAVIVNEVEKEQIIEDKFSFRSEMNRLKQV
FT                   EEATAEVKNLESKLVSGQAIIQGKLRQQFFFCDEQDISRQEERESTFDVSVDIPDVNSD
FT                   LQLEVEPLIDSLDWQVIGPETISTRIVLKLQLRIIDFREMGLALNPTGPTMVLDEAVLS
FT                   NQKQTIEVNTFELESFASNIRNIDVELTDLELGMISDYIIVEGQLEYDIYYLANLQTEP
FT                   NVECYQQEAVPFSTLIKTCGIETGMEVVIKEATEVEEIELLNNKTLKQETLIDLEVSVF
FT                   KREQVNVTVDETGRLITGQVVIDEGIEEFIIDIST"
     MSNFEQQVNL KRLELDRTVN KIKDIKAEVE AVESKVREGK IIFSGVVAED IIYVGQEGII        60
     YHQFEELDFS ICLPVEKESE DQEVELTPWI EYLDFQLADE GKHLEQKIML KVHTLLMKES       120
     QLKVKPGAAD TYRVAVIVNE VEKEQIIEDK FSFRSEMNRL KQVEEATAEV KNLESKLVSG       180
     QAIIQGKLRQ QFFFCDEQDI SRQEERESTF DVSVDIPDVN SDLQLEVEPL IDSLDWQVIG       240
     PETISTRIVL KLQLRIIDFR EMGLALNPTG PTMVLDEAVL SNQKQTIEVN TFELESFASN       300
     IRNIDVELTD LELGMISDYI IVEGQLEYDI YYLANLQTEP NVECYQQEAV PFSTLIKTCG       360
     IETGMEVVIK EATEVEEIEL LNNKTLKQET LIDLEVSVFK REQVNVTVDE TGRLITGQVV       420
     IDEGIEEFII DIST                                                         434
//

If you have problems or comments...

PBIL Back to PBIL home page