(data stored in SCRATCH zone)

EMBL: CP002105.PE72

CP002105.PE72        Location/Qualifiers
FT   CDS             complement(76077..77447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0073"
FT                   /product="amino acid carrier protein"
FT                   /note="COGs: COG1115 Na+/alanine symporter; InterPro
FT                   IPR001463; KEGG: ctc:CTC01975 Na(+)-linked D-alanine
FT                   glycine permease; PFAM: sodium:alanine symporter; SPTR:
FT                   Q892W1 Na(+)-linked D-alanine glycine permease; TIGRFAM:
FT                   amino acid carrier protein; PFAM: Sodium:alanine symporter
FT                   family; TIGRFAM: amino acid carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11624"
FT                   /db_xref="GOA:D9QST6"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:D9QST6"
FT                   /protein_id="ADL11624.1"
FT                   /translation="MQKQLLSFFNAASGIVWGVPMLVLLIGTGIYLTLRLRFITITKLP
FT                   HALKLIFTKNDDEGEGDVSGFEALATALSSTIGTGNIAGVATAISLGGPGAALWMWIAA
FT                   LFGTATKFAEGVLAVKYRVKNEAGEMSGGPMYYIEKGLGKKWRPLAIFFAFCGILVSWF
FT                   GIGATVQANSLADALDANFGISTWVSGTIMAILVGMVVLGGIKRIAKVAGKIVPLMSAL
FT                   YILSIAYILLTNLGELPEAISLIITSAFNGQSAVGGFAGAGVMMAIKRGVSRGVFSNEA
FT                   GVGSAPIAHASAKTNSPVRQGLIAMTGTFIDTILICTLTTLTIIVTGVWNSGLTGAALT
FT                   TEAFNVGMPGPGGFLIGIGIIFFAFSTALGWCFYGEKCVEYLLGNKAVKPYKILYLLCI
FT                   LIGANSKLNLIWAISDVANAMMIIPNLIALLGLSGIIIKISRKYFDPSLDEDINLVK"
     MQKQLLSFFN AASGIVWGVP MLVLLIGTGI YLTLRLRFIT ITKLPHALKL IFTKNDDEGE        60
     GDVSGFEALA TALSSTIGTG NIAGVATAIS LGGPGAALWM WIAALFGTAT KFAEGVLAVK       120
     YRVKNEAGEM SGGPMYYIEK GLGKKWRPLA IFFAFCGILV SWFGIGATVQ ANSLADALDA       180
     NFGISTWVSG TIMAILVGMV VLGGIKRIAK VAGKIVPLMS ALYILSIAYI LLTNLGELPE       240
     AISLIITSAF NGQSAVGGFA GAGVMMAIKR GVSRGVFSNE AGVGSAPIAH ASAKTNSPVR       300
     QGLIAMTGTF IDTILICTLT TLTIIVTGVW NSGLTGAALT TEAFNVGMPG PGGFLIGIGI       360
     IFFAFSTALG WCFYGEKCVE YLLGNKAVKP YKILYLLCIL IGANSKLNLI WAISDVANAM       420
     MIIPNLIALL GLSGIIIKIS RKYFDPSLDE DINLVK                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page