(data stored in SCRATCH zone)

EMBL: CP002105.PE74

CP002105.PE74        Location/Qualifiers
FT   CDS             78222..79505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0075"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sth:STH2583 hypothetical protein; SPTR: Q67L78
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11626"
FT                   /db_xref="InterPro:IPR024300"
FT                   /db_xref="UniProtKB/TrEMBL:D9QST8"
FT                   /protein_id="ADL11626.1"
FT                   /translation="MVDLTGIELVEVPVLVEEGNAQEMLVTEFELVESAKQVKSVDSVI
FT                   KNLNCEIIEDRVIVEGKIHKQILYIAEEDLVRYQKEEFEFSTLLSLPGVKPRMDVRINA
FT                   VIKGDNTELLEEGSLIKQKTLLDIHVLVEKRERLFVELGSKELVVVDRIVGENNNQTII
FT                   EGLLELEIPAFKIMDIEVQLEDISIKIFTDKVIVEGNIKEEIYFIDQKRVECYCKKKLS
FT                   FIQFIDLVGVKPGMNINLDSEIRDIQYRLSGDGVELSQRVMINSIAKATDRIEANLKVD
FT                   SEGKEVRLSKLINKTEEQILEEFLISLDTPAVKIKNVDIEMADIESELMTDRVILTGRL
FT                   KQNICFIGENNIERHQQKITSIDLFLDLPGVSPIDTAVDVESEIMFVKSDLASAGERLK
FT                   EKAVLKFSIKAFQDPPVTEEIAVVSVED"
     MVDLTGIELV EVPVLVEEGN AQEMLVTEFE LVESAKQVKS VDSVIKNLNC EIIEDRVIVE        60
     GKIHKQILYI AEEDLVRYQK EEFEFSTLLS LPGVKPRMDV RINAVIKGDN TELLEEGSLI       120
     KQKTLLDIHV LVEKRERLFV ELGSKELVVV DRIVGENNNQ TIIEGLLELE IPAFKIMDIE       180
     VQLEDISIKI FTDKVIVEGN IKEEIYFIDQ KRVECYCKKK LSFIQFIDLV GVKPGMNINL       240
     DSEIRDIQYR LSGDGVELSQ RVMINSIAKA TDRIEANLKV DSEGKEVRLS KLINKTEEQI       300
     LEEFLISLDT PAVKIKNVDI EMADIESELM TDRVILTGRL KQNICFIGEN NIERHQQKIT       360
     SIDLFLDLPG VSPIDTAVDV ESEIMFVKSD LASAGERLKE KAVLKFSIKA FQDPPVTEEI       420
     AVVSVED                                                                 427
//

If you have problems or comments...

PBIL Back to PBIL home page