(data stored in SCRATCH zone)

EMBL: CP002105.PE85

CP002105.PE85        Location/Qualifiers
FT   CDS             90038..91621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0086"
FT                   /product="N-acyl-D-amino-acid deacylase"
FT                   /EC_number="3.5.1.81"
FT                   /note="COGs: COG3653 N-acyl-D-aspartate/D-glutamate
FT                   deacylase; InterPro IPR006680:IPR012855:IPR011059; KEGG:
FT                   nth:Nther_2753 amidohydrolase 3; PFAM: amidohydrolase;
FT                   D-aminoacylase domain protein; PRIAM: N-acyl-D-amino-acid
FT                   deacylase; SPTR: B2A2T5 Amidohydrolase 3; PFAM:
FT                   D-aminoacylase, C-terminal region; Amidohydrolase family"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11637"
FT                   /db_xref="GOA:D9QSU9"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D9QSU9"
FT                   /protein_id="ADL11637.1"
FT                   /translation="MKLDLKLSGGTVVDGTGRDRFRTDIGIKDGEIVKLGDLKELNACI
FT                   EYNIEGLIIAPGFIDIHSHSKYSILANPKASGKVYQGVTTEVVGNCGSSAAPVTDRSTE
FT                   AVQDSLDKYNLELEWQSFAGYFGVLEKKGTALNIASLVGHGLLRKSVMGDEPRRPTNDE
FT                   LIEMKQLLASALEDGAWGLSTGLIYPPSSYAATEELMELAQVAAEYNGIYSTHLRSEGD
FT                   ELIKAVKEAIKIGRETGVSVEISHHKAIGKNNWGKVDKTLELITKARDEGFNISCDMYP
FT                   YLATSTGLAALLPAKIKEGGKEKVLRRLQNKKSVAEIKQYWQQKQQPKDYWSKILISEV
FT                   SSDDNQHLEGKSITQIAERRNQKPADIVIKLLIEEELQISMVKFSISEADLKKVLEFPE
FT                   TMISSDSLTRVKDGLLDQGKPHPRAYGSFPRVIDKFVKDKELLTLEEAVKKMSYLPAQK
FT                   LGLNNRGEIAVGKKADLAVFDLTEFTDQATYKQPHRYAAGLKYLIINGQPVVEDAEQTS
FT                   ALPGRVLINL"
     MKLDLKLSGG TVVDGTGRDR FRTDIGIKDG EIVKLGDLKE LNACIEYNIE GLIIAPGFID        60
     IHSHSKYSIL ANPKASGKVY QGVTTEVVGN CGSSAAPVTD RSTEAVQDSL DKYNLELEWQ       120
     SFAGYFGVLE KKGTALNIAS LVGHGLLRKS VMGDEPRRPT NDELIEMKQL LASALEDGAW       180
     GLSTGLIYPP SSYAATEELM ELAQVAAEYN GIYSTHLRSE GDELIKAVKE AIKIGRETGV       240
     SVEISHHKAI GKNNWGKVDK TLELITKARD EGFNISCDMY PYLATSTGLA ALLPAKIKEG       300
     GKEKVLRRLQ NKKSVAEIKQ YWQQKQQPKD YWSKILISEV SSDDNQHLEG KSITQIAERR       360
     NQKPADIVIK LLIEEELQIS MVKFSISEAD LKKVLEFPET MISSDSLTRV KDGLLDQGKP       420
     HPRAYGSFPR VIDKFVKDKE LLTLEEAVKK MSYLPAQKLG LNNRGEIAVG KKADLAVFDL       480
     TEFTDQATYK QPHRYAAGLK YLIINGQPVV EDAEQTSALP GRVLINL                     527
//

If you have problems or comments...

PBIL Back to PBIL home page