(data stored in SCRATCH zone)

EMBL: CP002105.PE93

CP002105.PE93        Location/Qualifiers
FT   CDS             100281..101888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0094"
FT                   /product="stage V sporulation protein B"
FT                   /note="COGs: COG2244 Membrane protein involved in the
FT                   export of O-antigen and teichoic acid; InterPro
FT                   IPR002797:IPR014249; KEGG: hor:Hore_21180 polysaccharide
FT                   biosynthesis protein; PFAM: polysaccharide biosynthesis
FT                   protein; SPTR: B8D011 Polysaccharide biosynthesis protein;
FT                   TIGRFAM: stage V sporulation protein B; PFAM:
FT                   Polysaccharide biosynthesis protein; TIGRFAM: stage V
FT                   sporulation protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11645"
FT                   /db_xref="GOA:D9QSV7"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR014249"
FT                   /db_xref="InterPro:IPR024923"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:D9QSV7"
FT                   /protein_id="ADL11645.1"
FT                   /translation="MAENRKQGFLQGALILTIAAFISKAMGLVYRILLTRLIGKEGIGL
FT                   YQMAYPIYTIILVISRSGIPVAISKLVAEKVAEDNRKSAYRIFRVALSISFILGLVFSA
FT                   GLIIAAKPLAQNVLRDARAFYSVLAIAPAVFFVSIMASYRGFFQGLQTMTPTAISQVVE
FT                   QLVRMSTMLLLAYLLLSKGVEFAAGGAAFGAVTGAVAGLTVLLYIYYKNKQEVDEFAVS
FT                   GPGDNLPVHRILQRLASLAIPVTLGALVLPLMQFIDATLIPWRLQVAGFSISEATGLYG
FT                   NFAGMAMVLVNFPTIITVSLAASLVPTISEAFSLGEDRLIKIRTQSALRLTVFICLPAA
FT                   AGLFLLATPLSQMLFAQPEAGIPLRYVSWGVIFVCLQQTSSSILQGIGKTVIPARNLFL
FT                   GGALNAVLNYFLTAIPSIGIRGAAVATASGFCLAALLNLLSIALLIGYDYNYRDMLLKP
FT                   ILAVVVMSLLVKLSYSQGITLLQNNTLSTLGAVVVGAVVYSLILLITGAVKEKDLKLIP
FT                   KIGDRLADILLKLGLVRG"
     MAENRKQGFL QGALILTIAA FISKAMGLVY RILLTRLIGK EGIGLYQMAY PIYTIILVIS        60
     RSGIPVAISK LVAEKVAEDN RKSAYRIFRV ALSISFILGL VFSAGLIIAA KPLAQNVLRD       120
     ARAFYSVLAI APAVFFVSIM ASYRGFFQGL QTMTPTAISQ VVEQLVRMST MLLLAYLLLS       180
     KGVEFAAGGA AFGAVTGAVA GLTVLLYIYY KNKQEVDEFA VSGPGDNLPV HRILQRLASL       240
     AIPVTLGALV LPLMQFIDAT LIPWRLQVAG FSISEATGLY GNFAGMAMVL VNFPTIITVS       300
     LAASLVPTIS EAFSLGEDRL IKIRTQSALR LTVFICLPAA AGLFLLATPL SQMLFAQPEA       360
     GIPLRYVSWG VIFVCLQQTS SSILQGIGKT VIPARNLFLG GALNAVLNYF LTAIPSIGIR       420
     GAAVATASGF CLAALLNLLS IALLIGYDYN YRDMLLKPIL AVVVMSLLVK LSYSQGITLL       480
     QNNTLSTLGA VVVGAVVYSL ILLITGAVKE KDLKLIPKIG DRLADILLKL GLVRG            535
//

If you have problems or comments...

PBIL Back to PBIL home page