(data stored in SCRATCH zone)

EMBL: CP002105.PE94

CP002105.PE94        Location/Qualifiers
FT   CDS             101890..103386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acear_0095"
FT                   /product="MazG family protein"
FT                   /note="COGs: COG3956 Protein containing tetrapyrrole
FT                   methyltransferase domain and MazG-like (predicted
FT                   pyrophosphatase) domain; InterPro
FT                   IPR004518:IPR000878:IPR011551; KEGG: cpf:CPF_2803 MazG
FT                   family protein; PFAM: MazG nucleotide pyrophosphohydrolase;
FT                   SPTR: C6Q4B5 MazG family protein; TIGRFAM: MazG family
FT                   protein; PFAM: Tetrapyrrole (Corrin/Porphyrin) Methylases;
FT                   MazG nucleotide pyrophosphohydrolase domain; TIGRFAM: MazG
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acear_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADL11646"
FT                   /db_xref="GOA:D9QSV8"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="InterPro:IPR011551"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:D9QSV8"
FT                   /protein_id="ADL11646.1"
FT                   /translation="MPEPELKGLKIIGLGYKGVDDLTLKAYKELKKVDKLLVRTDKHPV
FT                   IPHFKEEGIDVISFDNLLEKDLDSDQIVNSIAEQIRGYLDKNIEVDYAVPGSPLVGDES
FT                   VNRLVAKLPDDRIEVLPGLDSFGLLKRKFNFDSNGLQIMDSLAFRVEDIDTDQSLVLTN
FT                   ISNQKAASRLQEGLLEVYPADYSIQIIEVGKDYLTESRKLLLRNLDKLKEVDQLINLYI
FT                   PALSEKTEVDLDRLGSLDTLVKVVAKLRSPEGCPWDLEQTHYSLRPHLIEETYEVLESI
FT                   ELNDSAGLCEELGDLLLHVVFHAQLAEETGDFTIEDVISSISEKMIRRHPHVFGTKELS
FT                   TSDEVIKKWEEIKATEKNHKENESLLDITRGLPALMGAQEIQSKAAEIGFDWTDIDGAV
FT                   DKLKEELEEFQEALMFEQKDLVKEELGDLLFAVVNVSRFLDLDSELTLHDACCKFKARF
FT                   QYMEKLADDKLSGMSLTELEELWQKAKVKLEEEKINERFE"
     MPEPELKGLK IIGLGYKGVD DLTLKAYKEL KKVDKLLVRT DKHPVIPHFK EEGIDVISFD        60
     NLLEKDLDSD QIVNSIAEQI RGYLDKNIEV DYAVPGSPLV GDESVNRLVA KLPDDRIEVL       120
     PGLDSFGLLK RKFNFDSNGL QIMDSLAFRV EDIDTDQSLV LTNISNQKAA SRLQEGLLEV       180
     YPADYSIQII EVGKDYLTES RKLLLRNLDK LKEVDQLINL YIPALSEKTE VDLDRLGSLD       240
     TLVKVVAKLR SPEGCPWDLE QTHYSLRPHL IEETYEVLES IELNDSAGLC EELGDLLLHV       300
     VFHAQLAEET GDFTIEDVIS SISEKMIRRH PHVFGTKELS TSDEVIKKWE EIKATEKNHK       360
     ENESLLDITR GLPALMGAQE IQSKAAEIGF DWTDIDGAVD KLKEELEEFQ EALMFEQKDL       420
     VKEELGDLLF AVVNVSRFLD LDSELTLHDA CCKFKARFQY MEKLADDKLS GMSLTELEEL       480
     WQKAKVKLEE EKINERFE                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page