(data stored in ACNUC7421 zone)

EMBL: CP002116.PE1

CP002116.PE1         Location/Qualifiers
FT   CDS             150..1565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="COGs: COG0593 ATPase involved in DNA replication
FT                   initiation;
FT                   InterProIPR020591:IPR001957:IPR003593:IPR013159:IPR 013317;
FT                   KEGG: tde:TDE0001 chromosomal replication initiation
FT                   protein; PFAM: Chromosomal replication initiator DnaA;
FT                   Chromosomal replication initiator DnaA domain; SMART:
FT                   Chromosomal replication initiator DnaA domain; AAA ATPase;
FT                   SPTR: Chromosomal replication initiator protein dnaA;
FT                   TIGRFAM: chromosomal replication initiator protein DnaA;
FT                   PFAM: domain; Bacterial dnaA protein; TIGRFAM: chromosomal
FT                   replication initiator protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79161"
FT                   /db_xref="GOA:E1R6M9"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6M9"
FT                   /protein_id="ADK79161.1"
FT                   /translation="MNTQSRWDFSIFWQEALNQLKNELSDQEFVMWFSNISYHSSEEGK
FT                   LILSVPSAFYRDQVKQRYTGIIKEKLYELSGFQLDVDFIVTKRATSESPKEKNEVSDTP
FT                   QPPMAVKPVPVSVSPAKNDPPKKHPDLRPDYTFENFVIGENNTLAANACMAISKNPGTA
FT                   YNPCLIYGGVGLGKTHLIQSIGNYAWAHNPDIKIAYVTAETFTNEFIEAIHHNKNHQFK
FT                   NKYRKVDILLIDDIHFLQEKTGTQEELFHTFNALYETNKQLVFTCDRPVSELKQLTDRL
FT                   RSRFERGLNVDLQAPAFETRFAILKQKVEEKKVPIDDEVIELICRNVTTNVRDLEAALT
FT                   RLIAYADLLHKKVTLDIARQQLKDVFSNPKMSNITVEMIQRVTAEYFNLSPNDLRGKKR
FT                   TKAIAFPRQIAMYITREITEFSTTEVGLEFGGRDHTTVMHACQRVESRMQTDPSLEPII
FT                   QRIVRQIKEYGTK"
     MNTQSRWDFS IFWQEALNQL KNELSDQEFV MWFSNISYHS SEEGKLILSV PSAFYRDQVK        60
     QRYTGIIKEK LYELSGFQLD VDFIVTKRAT SESPKEKNEV SDTPQPPMAV KPVPVSVSPA       120
     KNDPPKKHPD LRPDYTFENF VIGENNTLAA NACMAISKNP GTAYNPCLIY GGVGLGKTHL       180
     IQSIGNYAWA HNPDIKIAYV TAETFTNEFI EAIHHNKNHQ FKNKYRKVDI LLIDDIHFLQ       240
     EKTGTQEELF HTFNALYETN KQLVFTCDRP VSELKQLTDR LRSRFERGLN VDLQAPAFET       300
     RFAILKQKVE EKKVPIDDEV IELICRNVTT NVRDLEAALT RLIAYADLLH KKVTLDIARQ       360
     QLKDVFSNPK MSNITVEMIQ RVTAEYFNLS PNDLRGKKRT KAIAFPRQIA MYITREITEF       420
     STTEVGLEFG GRDHTTVMHA CQRVESRMQT DPSLEPIIQR IVRQIKEYGT K                471
//

If you have problems or comments...

PBIL Back to PBIL home page