(data stored in ACNUC7421 zone)

EMBL: CP002116.PE10

CP002116.PE10        Location/Qualifiers
FT   CDS             7607..8773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0010"
FT                   /product="S-adenosylmethionine synthetase"
FT                   /EC_number="2.5.1.6"
FT                   /note="COGs: COG0192 S-adenosylmethionine synthetase;
FT                   InterPro IPR002133; KEGG: tde:TDE2470 S-adenosylmethionine
FT                   synthetase; PFAM: S-adenosylmethionine synthetase; PRIAM:
FT                   Methionine adenosyltransferase; SPTR: S-adenosylmethionine
FT                   synthetase; TIGRFAM: S-adenosylmethionine synthetase; PFAM:
FT                   S-adenosylmethionine synthetase, C-terminal domain;
FT                   S-adenosylmethionine synthetase, central domain;
FT                   S-adenosylmethionine synthetase, N-terminal domain;
FT                   TIGRFAM: S-adenosylmethionine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79170"
FT                   /db_xref="GOA:E1R6N8"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6N8"
FT                   /protein_id="ADK79170.1"
FT                   /translation="MDTKRKVLFTSESVSEGHPDKVCDQISDAVLDACLREDSTSRVAC
FT                   ETFTTTGMVLVGGEISTSTYVNLQDVVRGVVKRIGYDRPEYGLDWESMAVIDTIHNQSS
FT                   DISMGVTAGENKYKSQGAGDQGMMFGFACNETEELMPAPIIFAHRLLQKAAAVRKSGEC
FT                   SWMRPDAKSQVTVQYEGGKPVRIDTIVISHQHSPSVSIKEIEASLRKRVIEPVLGDTGL
FT                   IDEKTRFFINPTGRFVIGGPHGDSGLTGRKIIVDTYGGMGRHGGGAFSGKDPSKVDRSA
FT                   AYMARYVAKNIVAAGLCDRCELELSYAIGVPFPISVMVDTFGTATVPEERIEAAVEKVF
FT                   DLSPEGIIRELGLLAPIYEATAAYGHFGRDGFSWERVDKTEELKKAVG"
     MDTKRKVLFT SESVSEGHPD KVCDQISDAV LDACLREDST SRVACETFTT TGMVLVGGEI        60
     STSTYVNLQD VVRGVVKRIG YDRPEYGLDW ESMAVIDTIH NQSSDISMGV TAGENKYKSQ       120
     GAGDQGMMFG FACNETEELM PAPIIFAHRL LQKAAAVRKS GECSWMRPDA KSQVTVQYEG       180
     GKPVRIDTIV ISHQHSPSVS IKEIEASLRK RVIEPVLGDT GLIDEKTRFF INPTGRFVIG       240
     GPHGDSGLTG RKIIVDTYGG MGRHGGGAFS GKDPSKVDRS AAYMARYVAK NIVAAGLCDR       300
     CELELSYAIG VPFPISVMVD TFGTATVPEE RIEAAVEKVF DLSPEGIIRE LGLLAPIYEA       360
     TAAYGHFGRD GFSWERVDKT EELKKAVG                                          388
//

If you have problems or comments...

PBIL Back to PBIL home page