(data stored in ACNUC7421 zone)

EMBL: CP002116.PE100

CP002116.PE100       Location/Qualifiers
FT   CDS             105282..106430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0100"
FT                   /product="thymidine kinase"
FT                   /note="COGs: COG1435 Thymidine kinase; KEGG: bdu:BDU_798
FT                   thymidine kinase; SPTR: Thymidine kinase; PFAM: Thymidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79260"
FT                   /db_xref="GOA:E1R8B6"
FT                   /db_xref="InterPro:IPR001267"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8B6"
FT                   /protein_id="ADK79260.1"
FT                   /translation="MNEVKNNPETISFLKSLGFPSVRVHHSFNHFDFSRPDRRILVIGP
FT                   MGSGKTEYSARVWRDAQVALTKSETIARETSTDGADRRKVFFIRSLLDTQRFPDYPEDA
FT                   LAYRGGYERCGDYIARISDSFALEKLVHDMPEIGTWIVDEASFYDERLVYVVRNECQRR
FT                   GLIFIFPALILNFRRDIFNPTARLMLETATDVFPLTAYCEHPDCLEDSFYTYRYYQIDG
FT                   EECPALYFDPLIVIGGDRKKEDAVEPNYCTRCDRHHYLPGKEYTFFTLKPLGQQASGGN
FT                   SDPLKRELAALQERKGNSLLARHLRDKFGHDEEQRVNLNALKVARIAERALIYLYAEQN
FT                   LIPEELLLKLVNELGLDRVYMKKTLSENGRLVNLDQQILDGF"
     MNEVKNNPET ISFLKSLGFP SVRVHHSFNH FDFSRPDRRI LVIGPMGSGK TEYSARVWRD        60
     AQVALTKSET IARETSTDGA DRRKVFFIRS LLDTQRFPDY PEDALAYRGG YERCGDYIAR       120
     ISDSFALEKL VHDMPEIGTW IVDEASFYDE RLVYVVRNEC QRRGLIFIFP ALILNFRRDI       180
     FNPTARLMLE TATDVFPLTA YCEHPDCLED SFYTYRYYQI DGEECPALYF DPLIVIGGDR       240
     KKEDAVEPNY CTRCDRHHYL PGKEYTFFTL KPLGQQASGG NSDPLKRELA ALQERKGNSL       300
     LARHLRDKFG HDEEQRVNLN ALKVARIAER ALIYLYAEQN LIPEELLLKL VNELGLDRVY       360
     MKKTLSENGR LVNLDQQILD GF                                                382
//

If you have problems or comments...

PBIL Back to PBIL home page