(data stored in ACNUC7421 zone)

EMBL: CP002116.PE101

CP002116.PE101       Location/Qualifiers
FT   CDS             complement(106440..106844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0101"
FT                   /product="hemerythrin-like metal-binding protein"
FT                   /note="COGs: COG2703 Hemerythrin; InterPro
FT                   IPR012827:IPR012312:IPR016131; KEGG: dsa:Desal_0057
FT                   hemerythrin-like metal-binding protein; PFAM: Hemerythrin
FT                   HHE cation binding domain protein; SPTR: Hemerythrin-like
FT                   metal-binding protein; TIGRFAM: hemerythrin-like
FT                   metal-binding protein; PFAM: Hemerythrin HHE cation binding
FT                   domain; TIGRFAM: hemerythrin-like metal-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79261"
FT                   /db_xref="GOA:E1R8B7"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR012827"
FT                   /db_xref="InterPro:IPR016131"
FT                   /db_xref="InterPro:IPR035938"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8B7"
FT                   /protein_id="ADK79261.1"
FT                   /translation="MSLITWNSDYELGIPGIDAQHKKFVEILNTFYDQLAASDIESKTK
FT                   TLLDEVLDYTLYHFIEEERFMTKMGYEKLEEHKRLHEEIRGKIQAFRTSMDEGKLVMSM
FT                   KITSELKDWIKNHILIEDKKYAEKYLQTQQ"
     MSLITWNSDY ELGIPGIDAQ HKKFVEILNT FYDQLAASDI ESKTKTLLDE VLDYTLYHFI        60
     EEERFMTKMG YEKLEEHKRL HEEIRGKIQA FRTSMDEGKL VMSMKITSEL KDWIKNHILI       120
     EDKKYAEKYL QTQQ                                                         134
//

If you have problems or comments...

PBIL Back to PBIL home page