(data stored in ACNUC7421 zone)

EMBL: CP002116.PE102

CP002116.PE102       Location/Qualifiers
FT   CDS             complement(106846..107262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0102"
FT                   /product="hemerythrin-like metal-binding protein"
FT                   /note="COGs: COG2703 Hemerythrin; InterPro
FT                   IPR012827:IPR012312; KEGG: gem:GM21_3958 hemerythrin-like
FT                   metal-binding protein; PFAM: Hemerythrin HHE cation binding
FT                   domain protein; SPTR: Hemerythrin-like metal-binding
FT                   protein; TIGRFAM: hemerythrin-like metal-binding protein;
FT                   PFAM: Hemerythrin HHE cation binding domain; TIGRFAM:
FT                   hemerythrin-like metal-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79262"
FT                   /db_xref="GOA:E1R8B8"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR012827"
FT                   /db_xref="InterPro:IPR035938"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8B8"
FT                   /protein_id="ADK79262.1"
FT                   /translation="MGFMAWSSKFELGIPEMDEQHKKWLEILNSFYDHLSDKDLTTQMK
FT                   GLIQDVIDYTQYHFSEEEKLMASIGYHELNQQKQMHKEITDKIIRFKQRLDAGNLVIST
FT                   AVTSELKSWFKEHIMVEDKKYAEKYFQVTQKGGI"
     MGFMAWSSKF ELGIPEMDEQ HKKWLEILNS FYDHLSDKDL TTQMKGLIQD VIDYTQYHFS        60
     EEEKLMASIG YHELNQQKQM HKEITDKIIR FKQRLDAGNL VISTAVTSEL KSWFKEHIMV       120
     EDKKYAEKYF QVTQKGGI                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page