(data stored in ACNUC7421 zone)

EMBL: CP002116.PE103

CP002116.PE103       Location/Qualifiers
FT   CDS             107373..108086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0103"
FT                   /product="DNA alkylation repair enzyme"
FT                   /note="COGs: COG4912 DNA alkylation repair protein;
FT                   InterPro IPR014825; KEGG: mma:MM_0566 hypothetical protein;
FT                   PFAM: DNA alkylation repair enzyme; SPTR: Putative
FT                   uncharacterized protein; PFAM: DNA alkylation repair
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79263"
FT                   /db_xref="InterPro:IPR014825"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8B9"
FT                   /protein_id="ADK79263.1"
FT                   /translation="MEGNVVEFVRNELALHGDDSVRESGKRFFKEETKSYGVKTSVVTK
FT                   IAKSGFRELKGLDKNTILALCEELWKSGYMEESFIACHWAYALRETFIPDDFVIFEGWV
FT                   EHYVSNWASCDTLCNHTVGAFVEMYPEYIENLKRWAKSEGRWMRRAAAVSLIIPARSGL
FT                   FLEDIFEIADTLLLDQDDLVQKGYGWMLKAASQAHQREVYDYVMSKKAMMPRTSLRYAI
FT                   EKMPKELRVKAMAKQ"
     MEGNVVEFVR NELALHGDDS VRESGKRFFK EETKSYGVKT SVVTKIAKSG FRELKGLDKN        60
     TILALCEELW KSGYMEESFI ACHWAYALRE TFIPDDFVIF EGWVEHYVSN WASCDTLCNH       120
     TVGAFVEMYP EYIENLKRWA KSEGRWMRRA AAVSLIIPAR SGLFLEDIFE IADTLLLDQD       180
     DLVQKGYGWM LKAASQAHQR EVYDYVMSKK AMMPRTSLRY AIEKMPKELR VKAMAKQ          237
//

If you have problems or comments...

PBIL Back to PBIL home page