(data stored in ACNUC7421 zone)

EMBL: CP002116.PE104

CP002116.PE104       Location/Qualifiers
FT   CDS             complement(108090..108626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0104"
FT                   /product="protein of unknown function DUF1697"
FT                   /note="COGs: COG3797 conserved hypothetical protein;
FT                   InterPro IPR012545; KEGG: sna:Snas_5447 hypothetical
FT                   protein; PFAM: protein of unknown function DUF1697; SPTR:
FT                   Putative uncharacterized protein; PFAM: Protein of unknown
FT                   function (DUF1697)"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79264"
FT                   /db_xref="InterPro:IPR012545"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8C0"
FT                   /protein_id="ADK79264.1"
FT                   /translation="MNQYAAFLKGVNVGGKNRLSMAELREAMERHGFSAPKTYINSGNI
FT                   LFFHNAEKSEVKKELQDMIEQAFGLTIEVVVKTKEEINDTLQSDPFDTTTETEPAKKMV
FT                   MMLTSKVDPERFASIEADDKIIEKTYERGDLLYIYYRNGAGRSKLTIDYVEKVLGTSCT
FT                   ARNWNTLLKMKEILE"
     MNQYAAFLKG VNVGGKNRLS MAELREAMER HGFSAPKTYI NSGNILFFHN AEKSEVKKEL        60
     QDMIEQAFGL TIEVVVKTKE EINDTLQSDP FDTTTETEPA KKMVMMLTSK VDPERFASIE       120
     ADDKIIEKTY ERGDLLYIYY RNGAGRSKLT IDYVEKVLGT SCTARNWNTL LKMKEILE         178
//

If you have problems or comments...

PBIL Back to PBIL home page