(data stored in ACNUC7421 zone)

EMBL: CP002116.PE105

CP002116.PE105       Location/Qualifiers
FT   CDS             complement(108623..108964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0105"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="InterPro IPR001450:IPR017896; KEGG: dhd:Dhaf_2058
FT                   4Fe-4S ferredoxin iron-sulfur binding domain protein; PFAM:
FT                   4Fe-4S ferredoxin iron-sulfur binding domain protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79265"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8C1"
FT                   /protein_id="ADK79265.1"
FT                   /translation="MNSPRMLPNPPTPNEPIQFASDICNGCNLCVNICRSDVLMPHPEK
FT                   GKPPIVLYPDECWYCGTCVLECNRKGAIKLVHPMNQSVTVIWKRKATGENFRLGMKHPP
FT                   APNTRKPCS"
     MNSPRMLPNP PTPNEPIQFA SDICNGCNLC VNICRSDVLM PHPEKGKPPI VLYPDECWYC        60
     GTCVLECNRK GAIKLVHPMN QSVTVIWKRK ATGENFRLGM KHPPAPNTRK PCS              113
//

If you have problems or comments...

PBIL Back to PBIL home page