(data stored in ACNUC7421 zone)

EMBL: CP002116.PE106

CP002116.PE106       Location/Qualifiers
FT   CDS             complement(108961..110961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0106"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="COGs: COG1053 Succinate dehydrogenase/fumarate
FT                   reductase flavoprotein subunit; InterPro IPR006076; KEGG:
FT                   pen:PSEEN0175 putative oxidoreductase; PFAM: FAD dependent
FT                   oxidoreductase; SPTR: Predicted protein; PFAM: domain; FAD
FT                   binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79266"
FT                   /db_xref="GOA:E1R8C2"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8C2"
FT                   /protein_id="ADK79266.1"
FT                   /translation="MSTWHEYLNEGNPVPLWPYPVNYGRENRLSTDVLIFGGGIAGSHA
FT                   AIGARKAGARVLVVEKEATKWSGNGGAGVDHWLSACTNPCSKITPEEYTKRVLIDCGGY
FT                   DCGPLRYISSRESWEALLDCESMGVKIRDTDEEFKGAAFRDEETGLLFAYDYENRCEIR
FT                   VWGHNIKPSLYKGMRKLGVEILDRVMITAFLVEGEGASRRVCGAMGIHTRTGEFYIIEA
FT                   KAVVLATGLPGRIWNFSTEYRSTFRDPNCTGEGVSAAWRAGAEFTRLEESFPDSGTLAY
FT                   ISYAVGNAHNTWHGCPIVDANGKEIPWVDRDDKELSSIEERFRPAQGQRFMLGDGLRVP
FT                   PSYENQNKKLAPDLPDRIRSGEFVLPLYADLSRMPEKERRAIFGLMVGNEGRTRIPVYE
FT                   TLTKAGFDPDKDMLAVPVMDPSAYCHSNFWAGVGAPQWRMWGCGGVVVDWDLRTNLEGL
FT                   YAAGGAVFGAGAHSGAAASGRFAGRRAADFASSAEEVPVDDEQIKREKKRVYAPLNPEG
FT                   HPIGWKELNAGIGRVMQDYCGQFKSEGGLSEGLRLIGEIRESEAASVSAANPHELIHAV
FT                   ECLAMLDVCEAVIHASLARKASSDYLCFNRIDYPRMDPPEWRKLIALRKGKEGAEIRDL
FT                   PFDYFLKDSNAPSLEENYLAHGGLSGKEAHK"
     MSTWHEYLNE GNPVPLWPYP VNYGRENRLS TDVLIFGGGI AGSHAAIGAR KAGARVLVVE        60
     KEATKWSGNG GAGVDHWLSA CTNPCSKITP EEYTKRVLID CGGYDCGPLR YISSRESWEA       120
     LLDCESMGVK IRDTDEEFKG AAFRDEETGL LFAYDYENRC EIRVWGHNIK PSLYKGMRKL       180
     GVEILDRVMI TAFLVEGEGA SRRVCGAMGI HTRTGEFYII EAKAVVLATG LPGRIWNFST       240
     EYRSTFRDPN CTGEGVSAAW RAGAEFTRLE ESFPDSGTLA YISYAVGNAH NTWHGCPIVD       300
     ANGKEIPWVD RDDKELSSIE ERFRPAQGQR FMLGDGLRVP PSYENQNKKL APDLPDRIRS       360
     GEFVLPLYAD LSRMPEKERR AIFGLMVGNE GRTRIPVYET LTKAGFDPDK DMLAVPVMDP       420
     SAYCHSNFWA GVGAPQWRMW GCGGVVVDWD LRTNLEGLYA AGGAVFGAGA HSGAAASGRF       480
     AGRRAADFAS SAEEVPVDDE QIKREKKRVY APLNPEGHPI GWKELNAGIG RVMQDYCGQF       540
     KSEGGLSEGL RLIGEIRESE AASVSAANPH ELIHAVECLA MLDVCEAVIH ASLARKASSD       600
     YLCFNRIDYP RMDPPEWRKL IALRKGKEGA EIRDLPFDYF LKDSNAPSLE ENYLAHGGLS       660
     GKEAHK                                                                  666
//

If you have problems or comments...

PBIL Back to PBIL home page