(data stored in ACNUC7421 zone)

EMBL: CP002116.PE107

CP002116.PE107       Location/Qualifiers
FT   CDS             complement(111582..112223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0108"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: neu:NE2494 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79267"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8C3"
FT                   /protein_id="ADK79267.1"
FT                   /translation="MYRFEPIPGIFYGRFDRMVTYPAVLSMVHQYEESKESKEIEKLCL
FT                   TDEGYQPFRIYDFDGDFSILKNPLKIFFKTLWDGVLHLSIIRKRIGSLDDYYDDFVRTN
FT                   TKDMCPYCGLYLIDEVDVKTWEAFDHYVLKRIYPFLSVDFKNLASMCNKCNSGNKGNKD
FT                   PLHDSSNNRKKAFYLFKEDYGQIEIKVTLAHGDYENLFLRLVMRKVCLDR"
     MYRFEPIPGI FYGRFDRMVT YPAVLSMVHQ YEESKESKEI EKLCLTDEGY QPFRIYDFDG        60
     DFSILKNPLK IFFKTLWDGV LHLSIIRKRI GSLDDYYDDF VRTNTKDMCP YCGLYLIDEV       120
     DVKTWEAFDH YVLKRIYPFL SVDFKNLASM CNKCNSGNKG NKDPLHDSSN NRKKAFYLFK       180
     EDYGQIEIKV TLAHGDYENL FLRLVMRKVC LDR                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page