(data stored in ACNUC7421 zone)

EMBL: CP002116.PE109

CP002116.PE109       Location/Qualifiers
FT   CDS             complement(114950..116146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0111"
FT                   /product="carbamoyltransferase YgeW"
FT                   /note="COGs: COG0078 Ornithine carbamoyltransferase;
FT                   InterProIPR006130:IPR002082:IPR017702:IPR006132:IPR 006131;
FT                   KEGG: efa:EF2577 aspartate/ornithine carbamoyltransferase
FT                   family protein; PFAM: aspartate/ornithine
FT                   carbamoyltransferase carbamoyl-P binding domain;
FT                   aspartate/ornithine carbamoyltransferase Asp/Orn-binding
FT                   region; SPTR: Aspartate/ornithine carbamoyltransferase
FT                   family protein; TIGRFAM: carbamoyltransferase YgeW; PFAM:
FT                   Aspartate/ornithine carbamoyltransferase, carbamoyl-P
FT                   binding domain; Aspartate/ornithine carbamoyltransferase,
FT                   Asp/Orn binding domain; TIGRFAM: probable
FT                   carbamoyltransferase YgeW"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79269"
FT                   /db_xref="GOA:E1R8C5"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR017702"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8C5"
FT                   /protein_id="ADK79269.1"
FT                   /translation="MDRIGIKEKIKSLSRLRTEDMYLNDFFHTWKKSDQEIKAVFEVAD
FT                   ILRGMRNNNISTRLFDSGLGISLFRDNSTRTRFSYASACNMLGLEVQDLDEGKSQVAHG
FT                   ETVRETANMISFMADVIGIRDDMYIGKGHTYMKEVAASVQAGYDAGILEQRPTLVNLQC
FT                   DIDHPTQSMADALHLINHFGGIENLKGKKIAMTWAYSPSYGKPLSVPQGIMGLMSRFGM
FT                   AVTLAHPEGYEVMPEVEKIAEINSAKSGGTFSKTNSMAEAFKDADIVYPKSWAPFKAME
FT                   KRTGLYGKGDFDGIDKLEKELLGQNADHKDWECTEELMNSTKEGKALYMHCLPADITDV
FT                   SCEKGEVAASVFDRYRDPLYKQASFKPYIIAAMIFLSKVKNPADRLDTILNANLPRIV"
     MDRIGIKEKI KSLSRLRTED MYLNDFFHTW KKSDQEIKAV FEVADILRGM RNNNISTRLF        60
     DSGLGISLFR DNSTRTRFSY ASACNMLGLE VQDLDEGKSQ VAHGETVRET ANMISFMADV       120
     IGIRDDMYIG KGHTYMKEVA ASVQAGYDAG ILEQRPTLVN LQCDIDHPTQ SMADALHLIN       180
     HFGGIENLKG KKIAMTWAYS PSYGKPLSVP QGIMGLMSRF GMAVTLAHPE GYEVMPEVEK       240
     IAEINSAKSG GTFSKTNSMA EAFKDADIVY PKSWAPFKAM EKRTGLYGKG DFDGIDKLEK       300
     ELLGQNADHK DWECTEELMN STKEGKALYM HCLPADITDV SCEKGEVAAS VFDRYRDPLY       360
     KQASFKPYII AAMIFLSKVK NPADRLDTIL NANLPRIV                               398
//

If you have problems or comments...

PBIL Back to PBIL home page