(data stored in ACNUC7421 zone)

EMBL: CP002116.PE11

CP002116.PE11        Location/Qualifiers
FT   CDS             8785..9717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0011"
FT                   /product="protein of unknown function DUF340 membrane"
FT                   /note="COGs: COG2431 membrane protein; InterPro IPR005642;
FT                   KEGG: vvy:VV1444 hypothetical protein; PFAM: protein of
FT                   unknown function DUF340 membrane; SPTR: Putative
FT                   uncharacterized protein; PFAM: Membrane protein of unknown
FT                   function (DUF340)"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79171"
FT                   /db_xref="GOA:E1R6N9"
FT                   /db_xref="InterPro:IPR005642"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6N9"
FT                   /protein_id="ADK79171.1"
FT                   /translation="MEGIVSLLILLAFLGGGMMCAKSTFAPKPKGVTCIIAVILRILLL
FT                   FMGIRIGRLGMNIREVQTIGLLGLVFGSATIFGTVLFLIILNGLSGGNESKHKRGRSES
FT                   RRPSAKRLLWESLGLFAFVIVGIVAGKILPFASLIPNEAGTWTLYCLLFFIGMQMMQSD
FT                   IKFVSLLRDRRMLLLPLVTALGSICGGIMVSPLFHLSVGEAAALSAGFGWYSLSGVLIS
FT                   DLGNPLLGSAAFLVNLVRESLALFMIPLLGGLGLPHLAIGVGGATSMDVTLPLVETSCG
FT                   AGYVPLSIAHGALLSLLVPFLVPFFWGFA"
     MEGIVSLLIL LAFLGGGMMC AKSTFAPKPK GVTCIIAVIL RILLLFMGIR IGRLGMNIRE        60
     VQTIGLLGLV FGSATIFGTV LFLIILNGLS GGNESKHKRG RSESRRPSAK RLLWESLGLF       120
     AFVIVGIVAG KILPFASLIP NEAGTWTLYC LLFFIGMQMM QSDIKFVSLL RDRRMLLLPL       180
     VTALGSICGG IMVSPLFHLS VGEAAALSAG FGWYSLSGVL ISDLGNPLLG SAAFLVNLVR       240
     ESLALFMIPL LGGLGLPHLA IGVGGATSMD VTLPLVETSC GAGYVPLSIA HGALLSLLVP       300
     FLVPFFWGFA                                                              310
//

If you have problems or comments...

PBIL Back to PBIL home page