(data stored in ACNUC7421 zone)

EMBL: CP002116.PE110

CP002116.PE110       Location/Qualifiers
FT   CDS             complement(116187..117647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0112"
FT                   /product="Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit"
FT                   /note="COGs: COG0031 Cysteine synthase; InterPro IPR001926;
FT                   KEGG: pmo:Pmob_1727 pyridoxal-5'-phosphate-dependent
FT                   protein beta subunit; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit;
FT                   SPTR: Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit; PFAM: Pyridoxal-phosphate dependent enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79270"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8C6"
FT                   /protein_id="ADK79270.1"
FT                   /translation="MIDLTTNEEQIQKNAIRCKEQGILFPTFAEMREPETISEDIKKKL
FT                   KDVGLWDVNSLNLYRVNWQNEPKKFGGGFGDVNYMELPSSLTGTRARILALVGKWFPTG
FT                   AHKVGASYSCLAPRLVTGQFNPMKEKAVWPSTGNYCRGGAYISRLLACDSIAILPEEMS
FT                   QERFDWLKNIAGETIATPGCESNVKEIFDKCRELTESRGDTIEIFNQFDQFPNHLWHYE
FT                   VTGHSMEKVLKKAMGEDSRFAGTCLSSGSSGTLGSGEYLKTLYPKAKLSVAEALQCPTL
FT                   YNNGFGGHRIEGIGDKHVPWIHNLKNTDMVIAIDDEQTIRLLRLFNEPVGREYLKENGV
FT                   PAELLDQLDLLGISSIGNLIGTIKMAKYYELTEEDVLMTIFTDSFEMYESRLKELEEAR
FT                   GAYTREDAIRDYELINQVTFDHTMELSYQEQKRIHNLKYYTWVEQQDKTYDEINAQWYD
FT                   HDYWTNLYKVTPKLDELIIDFNRRIKAL"
     MIDLTTNEEQ IQKNAIRCKE QGILFPTFAE MREPETISED IKKKLKDVGL WDVNSLNLYR        60
     VNWQNEPKKF GGGFGDVNYM ELPSSLTGTR ARILALVGKW FPTGAHKVGA SYSCLAPRLV       120
     TGQFNPMKEK AVWPSTGNYC RGGAYISRLL ACDSIAILPE EMSQERFDWL KNIAGETIAT       180
     PGCESNVKEI FDKCRELTES RGDTIEIFNQ FDQFPNHLWH YEVTGHSMEK VLKKAMGEDS       240
     RFAGTCLSSG SSGTLGSGEY LKTLYPKAKL SVAEALQCPT LYNNGFGGHR IEGIGDKHVP       300
     WIHNLKNTDM VIAIDDEQTI RLLRLFNEPV GREYLKENGV PAELLDQLDL LGISSIGNLI       360
     GTIKMAKYYE LTEEDVLMTI FTDSFEMYES RLKELEEARG AYTREDAIRD YELINQVTFD       420
     HTMELSYQEQ KRIHNLKYYT WVEQQDKTYD EINAQWYDHD YWTNLYKVTP KLDELIIDFN       480
     RRIKAL                                                                  486
//

If you have problems or comments...

PBIL Back to PBIL home page