(data stored in ACNUC7421 zone)

EMBL: CP002116.PE111

CP002116.PE111       Location/Qualifiers
FT   CDS             complement(117651..118865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0113"
FT                   /product="peptidase M20"
FT                   /note="COGs: COG0624 Acetylornithine
FT                   deacetylase/Succinyl-diaminopimelate desuccinylase and
FT                   related deacylase; InterPro IPR002933:IPR011650:IPR001261;
FT                   KEGG: kol:Kole_2070 M20/DapE family protein YgeY; PFAM:
FT                   peptidase M20; peptidase dimerisation domain protein; SPTR:
FT                   Peptidase; PFAM: Peptidase family M20/M25/M40; Peptidase
FT                   dimerisation domain; TIGRFAM: putative selenium metabolism
FT                   hydrolase; M20/DapE family protein YgeY"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79271"
FT                   /db_xref="GOA:E1R8C7"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017706"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8C7"
FT                   /protein_id="ADK79271.1"
FT                   /translation="MKQEILRKAEEYRDYVAQTLSEMVKIPSYSGKEEAICKRIKEICE
FT                   DAGFDEVRTDKLGSVIARIGNGPKSIAFDAHIDTVEIGDPDQWEKEPFSGLIADGLVHG
FT                   RGSSDQKGGAASMITAGRILKDINYNGQFTIYFTFTVMEEDCDGMCWKYLIEEEKLKPD
FT                   FYVSTEPTSTRIYRGHRGRMEMMVRLKGISAHGSAPERGESAAYKAARAALAMEKLNKD
FT                   LQPDEDNFLGKGTIVVSQIDVKGPSQCAVPDQAMLYLDRRLTWGEDADLAIGQVKEYIG
FT                   KALDCPPEEIDVTMPEYTKRGYRDYDYSQELYFPTWKMDADHPLVESGVDAYKTLWGKD
FT                   PVVDKWTFSTNAVATTGRHKIPAIGFGPGDESQAHAPNEINRIEDLVICAAFYAMLPYS
FT                   LEKRI"
     MKQEILRKAE EYRDYVAQTL SEMVKIPSYS GKEEAICKRI KEICEDAGFD EVRTDKLGSV        60
     IARIGNGPKS IAFDAHIDTV EIGDPDQWEK EPFSGLIADG LVHGRGSSDQ KGGAASMITA       120
     GRILKDINYN GQFTIYFTFT VMEEDCDGMC WKYLIEEEKL KPDFYVSTEP TSTRIYRGHR       180
     GRMEMMVRLK GISAHGSAPE RGESAAYKAA RAALAMEKLN KDLQPDEDNF LGKGTIVVSQ       240
     IDVKGPSQCA VPDQAMLYLD RRLTWGEDAD LAIGQVKEYI GKALDCPPEE IDVTMPEYTK       300
     RGYRDYDYSQ ELYFPTWKMD ADHPLVESGV DAYKTLWGKD PVVDKWTFST NAVATTGRHK       360
     IPAIGFGPGD ESQAHAPNEI NRIEDLVICA AFYAMLPYSL EKRI                        404
//

If you have problems or comments...

PBIL Back to PBIL home page