(data stored in ACNUC7421 zone)

EMBL: CP002116.PE112

CP002116.PE112       Location/Qualifiers
FT   CDS             119253..119996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0114"
FT                   /product="Hydantoin racemase"
FT                   /note="COGs: COG4126 Hydantoin racemase; InterPro
FT                   IPR015942; KEGG: rpf:Rpic12D_1297 Asp/Glu/hydantoin
FT                   racemase; PFAM: Asp/Glu/hydantoin racemase; PRIAM:
FT                   Hydantoin racemase; SPTR: Putative uncharacterized protein;
FT                   PFAM: Asp/Glu/Hydantoin racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79272"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8C8"
FT                   /protein_id="ADK79272.1"
FT                   /translation="MRCLIVNPNTSVHMTSSINHTMEELDKGDVSFDVISAEIGPESLE
FT                   SFYEYNLAASGVAYTLKKMDMQIYDGVLLACFGDPGLYGLKESLSCPVVGIAEASLSMS
FT                   LLLGYKFAIIVSLQKAVPMMINMVHQYGLGQRMAGVFPLNMPVLDLEKDKVSVIEKIRQ
FT                   VSRKAIIQGAETLILGCAGMTGIAKEVEKEMKVPVIDPVSAGFHSLKAIIESKLTTARH
FT                   GLYEPVPAKRIIGAEGRDSKYFGYF"
     MRCLIVNPNT SVHMTSSINH TMEELDKGDV SFDVISAEIG PESLESFYEY NLAASGVAYT        60
     LKKMDMQIYD GVLLACFGDP GLYGLKESLS CPVVGIAEAS LSMSLLLGYK FAIIVSLQKA       120
     VPMMINMVHQ YGLGQRMAGV FPLNMPVLDL EKDKVSVIEK IRQVSRKAII QGAETLILGC       180
     AGMTGIAKEV EKEMKVPVID PVSAGFHSLK AIIESKLTTA RHGLYEPVPA KRIIGAEGRD       240
     SKYFGYF                                                                 247
//

If you have problems or comments...

PBIL Back to PBIL home page