(data stored in ACNUC7421 zone)

EMBL: CP002116.PE114

CP002116.PE114       Location/Qualifiers
FT   CDS             121640..122818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0116"
FT                   /product="peptidase M20"
FT                   /note="COGs: COG0624 Acetylornithine
FT                   deacetylase/Succinyl-diaminopimelate desuccinylase and
FT                   related deacylase; InterPro IPR002933:IPR011650:IPR001261;
FT                   KEGG: mta:Moth_0710 peptidase; PFAM: peptidase M20;
FT                   peptidase dimerisation domain protein; SPTR: Peptidase M20;
FT                   PFAM: Peptidase family M20/M25/M40; Peptidase dimerisation
FT                   domain; TIGRFAM: putative selenium metabolism hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79274"
FT                   /db_xref="GOA:E1R8D0"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017706"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8D0"
FT                   /protein_id="ADK79274.1"
FT                   /translation="MKLNSSQQKEVLAFARQLVCEPGNSGDEEKSALLIEKKMNELGYN
FT                   QVRVDPYGSVIGIINGSKPGPTILFDGHVDVVPIHEPDEWHHDPYGGEVVGDKLISRGS
FT                   ADMKGSVTAMIFAASYLDKEKLLGTIIVSASVAEELIPGRALEKILDEYKVDAVVVGEP
FT                   TKLRLGFTEKGRCSISMTVTGEVAHSSSPELGKNAIYIANDAIRRIREIPVNSDPFLGD
FT                   EVRELVELRSEPTPGYGSVPYYCWGLWECRILPGESEQALLNKFVSSQKGSEWEERIHF
FT                   QFETIDIPNFTGTHLIGKDFLPAWREDKNSGLYKQMEAAVEKSGIPVEYEPIYYGSNAL
FT                   MSCGVKKLPTVIFGPGDVALAHKPDEYLRIQDLWKATKIFNHIMELNGKYTY"
     MKLNSSQQKE VLAFARQLVC EPGNSGDEEK SALLIEKKMN ELGYNQVRVD PYGSVIGIIN        60
     GSKPGPTILF DGHVDVVPIH EPDEWHHDPY GGEVVGDKLI SRGSADMKGS VTAMIFAASY       120
     LDKEKLLGTI IVSASVAEEL IPGRALEKIL DEYKVDAVVV GEPTKLRLGF TEKGRCSISM       180
     TVTGEVAHSS SPELGKNAIY IANDAIRRIR EIPVNSDPFL GDEVRELVEL RSEPTPGYGS       240
     VPYYCWGLWE CRILPGESEQ ALLNKFVSSQ KGSEWEERIH FQFETIDIPN FTGTHLIGKD       300
     FLPAWREDKN SGLYKQMEAA VEKSGIPVEY EPIYYGSNAL MSCGVKKLPT VIFGPGDVAL       360
     AHKPDEYLRI QDLWKATKIF NHIMELNGKY TY                                     392
//

If you have problems or comments...

PBIL Back to PBIL home page