(data stored in ACNUC7421 zone)

EMBL: CP002116.PE115

CP002116.PE115       Location/Qualifiers
FT   CDS             122799..123008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0117"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: wsu:WS1642 flagellar biosynthesis regulator
FT                   FlhF; SPTR: Trypsin type 7"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79275"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8D1"
FT                   /protein_id="ADK79275.1"
FT                   /translation="MESILISISHTTGEQDLMSSTKEKTKIDMTDVTQKEVVCPYDEEK
FT                   VFLKIKSYRFLYFNEKGEMRNEES"
     MESILISISH TTGEQDLMSS TKEKTKIDMT DVTQKEVVCP YDEEKVFLKI KSYRFLYFNE        60
     KGEMRNEES                                                                69
//

If you have problems or comments...

PBIL Back to PBIL home page