(data stored in ACNUC7421 zone)

EMBL: CP002116.PE116

CP002116.PE116       Location/Qualifiers
FT   CDS             122995..123981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0118"
FT                   /product="basic membrane lipoprotein"
FT                   /note="COGs: COG1744 Uncharacterized ABC-type transport
FT                   system periplasmic component/surface lipoprotein; InterPro
FT                   IPR003760; KEGG: ter:Tery_3674 basic membrane lipoprotein;
FT                   PFAM: basic membrane lipoprotein; SPTR: Putative
FT                   uncharacterized protein; PFAM: Basic membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79276"
FT                   /db_xref="GOA:E1R8D2"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E1R8D2"
FT                   /protein_id="ADK79276.1"
FT                   /translation="MKNLKLAVVLVLLSVLVFGGCQGSSDDKDAGTKSAESKLKVAMVL
FT                   PGLKTDEAFNQFTYEGMMRAAEDLDIETAFVEEVKQDEQIEVIRQFAQQGYDIIIGQGG
FT                   QFGEALQTVAKEYPDQEFVFSVATDTGGVPNLTAVTVSYSHAGYIAGIMAGQMTKNNKV
FT                   AMILGEWYTPHRQMWESFQKGVAASGKDVEVKSVATGSWSDVNKAREASLALIADGVDV
FT                   LLPVLDAAYVGVLSAAQDSDDVLVVGSVLDMAKVAPEVVVGSVVYNWNELGYQEATGEI
FT                   TDGGTHILGIKENGITPVLNDLLSDEGKTAVEDAIAGLKAGNIDILP"
     MKNLKLAVVL VLLSVLVFGG CQGSSDDKDA GTKSAESKLK VAMVLPGLKT DEAFNQFTYE        60
     GMMRAAEDLD IETAFVEEVK QDEQIEVIRQ FAQQGYDIII GQGGQFGEAL QTVAKEYPDQ       120
     EFVFSVATDT GGVPNLTAVT VSYSHAGYIA GIMAGQMTKN NKVAMILGEW YTPHRQMWES       180
     FQKGVAASGK DVEVKSVATG SWSDVNKARE ASLALIADGV DVLLPVLDAA YVGVLSAAQD       240
     SDDVLVVGSV LDMAKVAPEV VVGSVVYNWN ELGYQEATGE ITDGGTHILG IKENGITPVL       300
     NDLLSDEGKT AVEDAIAGLK AGNIDILP                                          328
//

If you have problems or comments...

PBIL Back to PBIL home page